Navigation Links
GIBCO Kanamycin Sulfate (100X) liquid from Invitrogen

ProductsGIBCO Kanamycin Sulfate (100X) liquid from Invitrogen
Company Invitrogen
Item GIBCO Kanamycin Sulfate (100X) liquid
Price 
Description Kanamycin is used for selection of resistant bacteria. C18H36N4O11xH2SO4. Contains 10 mg/ml kanamycin (base) utilizing kanamycin sulfate in 0.85% saline.
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. GIBCO Dulbeccos Modified Eagle Medium (D-MEM); powder (high glucose) from Invitrogen
2. GIBCO CD 293 AGT from Invitrogen
3. GIBCO Iscoves Modified Dulbeccos Medium (IMDM); powder from Invitrogen
4. GIBCO RPMI Medium 1640; powder from Invitrogen
5. GIBCO AmnioMAX-C100 Basal Medium liquid from Invitrogen
6. GIBCO RPMI Medium 1640; powder from Invitrogen
7. GIBCO Earles Balanced Salt Solution (EBSS) (1X); liquid from Invitrogen
8. GIBCO Bovine Serum from Invitrogen
9. GIBCO Graces Insect Cell Culture Medium; powder from Invitrogen
10. GIBCO Newborn Calf Serum from Invitrogen
11. GIBCO Sf-900 II SFM (1X) liquid from Invitrogen
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products:
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3