Navigation Links
GIBCO Donor Calf Serum from Invitrogen

ProductsGIBCO Donor Calf Serum from Invitrogen
Company Invitrogen
Item GIBCO Donor Calf Serum
Price 
Description Performance, mycoplasma, virus, and endotoxin tested
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. GIBCO Dulbeccos Modified Eagle Medium (D-MEM); powder (high glucose) from Invitrogen
2. GIBCO CD 293 AGT from Invitrogen
3. GIBCO Iscoves Modified Dulbeccos Medium (IMDM); powder from Invitrogen
4. GIBCO RPMI Medium 1640; powder from Invitrogen
5. GIBCO AmnioMAX-C100 Basal Medium liquid from Invitrogen
6. GIBCO RPMI Medium 1640; powder from Invitrogen
7. GIBCO Earles Balanced Salt Solution (EBSS) (1X); liquid from Invitrogen
8. GIBCO Bovine Serum from Invitrogen
9. GIBCO Graces Insect Cell Culture Medium; powder from Invitrogen
10. GIBCO Newborn Calf Serum from Invitrogen
11. GIBCO Sf-900 II SFM (1X) liquid from Invitrogen
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... a partial recombinant NFKBIB. Immunogen: ... partial recombinant protein with GST tag. ... Accession: BC015528 Protein Accession ... 604495, GeneID: 4793 ...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:7/20/2017)... , July 20, 2017 Delta (NYSE: DAL ... board any Delta aircraft at Reagan Washington National Airport (DCA). ... Delta launches biometrics to ... Delta,s biometric ... Sky Club is now integrated into the boarding process to allow ...
(Date:5/16/2017)... 2017  Veratad Technologies, LLC ( www.veratad.com ), an ... identity verification solutions, announced today they will participate as ... 15 thru May 17, 2017, in Washington ... Center. Identity impacts the lives of ... quickly evolving digital world, defining identity is critical to ...
(Date:4/18/2017)... Inc., a global expert in SoC-based imaging and computing solutions, has ... features the company,s hybrid codec technology. A demonstration utilizing TeraFaces ® ... be showcased during the upcoming Medtec Japan at Tokyo Big Sight ... Las Vegas Convention Center April 24-27. ... Click here for an image of the ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... ... AMRI, a global contract research, development and manufacturing organization ... quality of life, will now be offering its impurity solutions as a stand-alone ... for all new drug products, including the finalization of ICH M7 earlier this ...
(Date:10/11/2017)... USA (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s ... take place on 7th and 8th June 2018 in San Francisco, CA. The Summit ... as well as several distinguished CEOs, board directors and government officials from around the ...
(Date:10/11/2017)... ... October 11, 2017 , ... A new study published ... frozen and fresh in vitro fertilization (IVF) transfer cycles. The multi-center ... success. , After comparing the results from the fresh and frozen transfer cohorts, ...
(Date:10/10/2017)... ... ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. spent ... entitled “Stem Cells and Their Regenerative Powers,” was held on August 31st, 2017 ... joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic Surgery, Grossmont ...
Breaking Biology Technology: