Navigation Links
GIBCO Calf Serum; Heat-Inactivated from Invitrogen

ProductsGIBCO Calf Serum; Heat-Inactivated from Invitrogen
Company Invitrogen
Item GIBCO Calf Serum; Heat-Inactivated
Price 
Description Mycoplasma and virus tested
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. GIBCO Dulbeccos Modified Eagle Medium (D-MEM); powder (high glucose) from Invitrogen
2. GIBCO CD 293 AGT from Invitrogen
3. GIBCO Iscoves Modified Dulbeccos Medium (IMDM); powder from Invitrogen
4. GIBCO RPMI Medium 1640; powder from Invitrogen
5. GIBCO AmnioMAX-C100 Basal Medium liquid from Invitrogen
6. GIBCO RPMI Medium 1640; powder from Invitrogen
7. GIBCO Earles Balanced Salt Solution (EBSS) (1X); liquid from Invitrogen
8. GIBCO Bovine Serum from Invitrogen
9. GIBCO Graces Insect Cell Culture Medium; powder from Invitrogen
10. GIBCO Newborn Calf Serum from Invitrogen
11. GIBCO Sf-900 II SFM (1X) liquid from Invitrogen
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial ... (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant ... Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: ... AAH15528 OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products:
(Date:3/30/2017)... 30, 2017  On April 6-7, 2017, Sequencing.com will ... hackathon at Microsoft,s headquarters in ... focus on developing health and wellness apps that provide ... the Genome is the first hackathon for personal ... largest companies in the genomics, tech and health industries ...
(Date:3/30/2017)... -- Trends, opportunities and forecast in this market to ... AFIS, iris recognition, facial recognition, hand geometry, vein recognition, ... industry (government and law enforcement, commercial and retail, health ... and by region ( North America , ... , and the Rest of the World) ...
(Date:3/28/2017)... -- The report "Video Surveillance Market by ... Devices), Software (Video Analytics, VMS), and Service (VSaaS, Installation ... 2022", published by MarketsandMarkets, the market was valued at ... reach USD 75.64 Billion by 2022, at a CAGR ... considered for the study is 2016 and the forecast ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... ... August 15, 2017 , ... JULABO USA introduces ... the new website makes it easy to navigate through the site whether you’re ... find detailed product information, educational industry content and visit the company’s social media ...
(Date:8/11/2017)... San Antonio, Texas (PRWEB) , ... August 11, 2017 , ... ... launching a rebranding campaign this month that will incorporate important key elements including a ... to thank the community that has supported them, Bill Miller has partnered with the ...
(Date:8/10/2017)... ... 09, 2017 , ... The era of using extracellular vesicles ... team at Capricor Therapeutics, Inc. utilized a cardiosphere-derived stem-like cell culturing process to ... Travis Antes, head of analytical development at Capricor Therapeutics Inc., will be the ...
(Date:8/10/2017)... ... August 10, 2017 , ... ... Kinokuniya Company Ltd. as its exclusive sales representative for SPIE Journals in Japan. ... the SPIE Digital Library in Japan. , “We look forward to expanding our ...
Breaking Biology Technology: