Navigation Links
Freedom EVOlyzer from Tecan

ProductsFreedom EVOlyzer from Tecan
Company Tecan
Item Freedom EVOlyzer
Price 
Description The Freedom EVOlyzer is Tecans new Enzyme-Linked Immunosorbent Assay (ELISA) analyzer offering fully automated microplate processing. Freedom EVOlyzer is a dedicated EVO platform for reliableELISA Processing and includes state-of-the art reader, washer and incubation units operated by the new sophisticated EVOlyzer software. The Freedom EVOlyzer is available in three sizes - 100, 150, 200 - ideal to serve all throughput and batch size requirements. Continuous loading and parallel sample pipetting are new, powerful features that improve throughput and allow efficient utilization as well as optimal scheduling of laboratory tasks. Integration with the laboratory LIMS and flexible worklist managementare easily performed via an integrated bi-directional ASTM (American Society for Testing of Materials) interface.

Highlights of the Freedom EVOlyzer are:
  • IVD-D 98/79/EC, Annex III compliant open system for ELISA processing
  • fully automated pipetting, incubating, washing and data reduction
  • barcode identification (samples, reagents, microplates)
  • increased throughput with continuous loading, parallel sample pipetting and large plate storage capability
  • integrated user and process safety concept: grid control, liquid level control, door locks, status lamp, integrated maintenance, user management
  • Wizard guided easy-to-use Run Control Software, designed for touch screen operation
  • Info TecanTecan
    Tecan U.S., Inc.
    4022 Stirrup Creek Road
    Suite 310
    Durham, NC 27703

    Customer Service: (800) 338-3226
    Fax Number: (919) 361-5201
    Web Site: http://www.tecan.com
    NOTE: Price information is approximate list price and actual prices may vary.

    Related biology products :

    1. Freedom EVO Clinical from Tecan
    2. Freedom EVO 150 from Tecan
    3. Freedom EVOware from Tecan
    4. Freedom EVO96R from Tecan
    5. Freedom EVO384R from Tecan
    6. Freedom EVO 75 from Tecan
    7. Connect from Tecan
    8. ELISA Biopharma from Tecan
    9. HS 4800 Hybridization Station from Tecan
    10. HS 400 Hybridization Station from Tecan
    11. GenePaint from Tecan
    ... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
    Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
    Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
    ... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
    Biology Products:
    (Date:3/30/2017)... ANGELES , March 30, 2017  On April ... Hack the Genome hackathon at Microsoft,s ... exciting two-day competition will focus on developing health and ... Hack the Genome is the ... been tremendous. The world,s largest companies in the genomics, ...
    (Date:3/28/2017)... India , March 28, 2017 ... IP, Biometrics), Hardware (Camera, Monitors, Servers, Storage Devices), Software ... Vertical, and Region - Global Forecast to 2022", published ... Billion in 2016 and is projected to reach USD ... between 2017 and 2022. The base year considered for ...
    (Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
    Breaking Biology News(10 mins):
    (Date:10/12/2017)... , ... October 12, 2017 , ... ... Vilnius, Lithuania, announced today that they have entered into a multiyear collaboration to ... provide CRISPR researchers with additional tools for gene editing across all applications. , ...
    (Date:10/12/2017)... ... 12, 2017 , ... AMRI, a global contract research, development ... patient outcomes and quality of life, will now be offering its impurity solutions ... new regulatory requirements for all new drug products, including the finalization of ICH ...
    (Date:10/11/2017)... ... October 11, 2017 , ... The CRISPR-Cas9 system ... experiments and avoiding the use of exogenous expression plasmids. The simplicity of programming ... systematic gain-of-function studies. , This complement to loss-of-function studies, such as with ...
    (Date:10/11/2017)... , ... October 11, 2017 , ... ... announced today it will be hosting a Webinar titled, “Pathology is going digital. ... Associates , on digital pathology adoption best practices and how Proscia improves lab ...
    Breaking Biology Technology: