Navigation Links
Experion RNA StdSens Reagents and Supplies, for 10 chips from Bio-Rad

ProductsExperion RNA StdSens Reagents and Supplies, for 10 chips from Bio-Rad
Company Bio-Rad
Item Experion RNA StdSens Reagents and Supplies, for 10 chips
Price 
Description Experion StdSens reagents and supplies, for 10 chips, provides the reagents and supplies sufficient to perform standard-sensitivity RNA analysis (nanogram levels) with 10 chips on the Experion automated electrophoresis system. Supplied are 1,250 microliters RNA gel, 20 microliters RNA StdSens stain, 20 microliters RNA ladder, 900 microliters RNA StdSens loading buffer, and 2 spin filters.
Info Bio-RadBio-Rad
Bio-Rad Laboratories, Inc.
Life Science Research Group
2000 Alfred Nobel Drive
Hercules, CA 94547
USA
Customer Service: 800-424 6723
Fax Number: 800-879 2289
Web Site: http://discover.bio-rad.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Experion RNA StdSens Analysis Kit for 25 Chips from Bio-Rad
2. Experion RNA HighSens Analysis Kit for 25 Chips from Bio-Rad
3. Experion RNA HighSens Reagents and Supplies, for 10 chips from Bio-Rad
4. Experion RNA HighSens Chips, 10 from Bio-Rad
5. Experion System, 100-240 V from Bio-Rad
6. Experion RNA StdSens Chips, 10 from Bio-Rad
7. Experion Pro260 Reagents and Supplies, for 10 chips from Bio-Rad
8. Experion Pro260 Chips, 10 from Bio-Rad
9. Experion Pro260 Analysis Kit for 10 Chips from Bio-Rad
10. Experion Software, PC from Bio-Rad
11. Experion Spin Filters, 10 from Bio-Rad
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... ... October 11, 2017 , ... Personal eye wash is a basic first aid supply for any ... So which eye do you rinse first if a dangerous substance enters both eyes? It’s ... Wash with its unique dual eye piece. , “Whether its dirt and debris, or ...
(Date:10/11/2017)... BioMarketing, a leading provider of patient support solutions, has announced ... network, which will launch this week. The VMS CNEs will ... to enhance the patient care experience by delivering peer-to-peer education ... professionals to help women who have been diagnosed and are ... ...
(Date:10/11/2017)... ... 11, 2017 , ... A new study published in Fertility ... fresh in vitro fertilization (IVF) transfer cycles. The multi-center matched cohort ... After comparing the results from the fresh and frozen transfer cohorts, the authors ...
Breaking Biology Technology: