Navigation Links
EPH electrode, anode from GE Healthcare, formerly Amersham Biosciences

ProductsEPH electrode, anode from GE Healthcare, formerly Amersham Biosciences
Company GE Healthcare, formerly Amersham Biosciences
Item EPH electrode, anode
Price $277.00
Description EPH electrode, anode, 1. Category: Electrophoresis Systems & Standards & Reagents, IEF & SDS-PAGE & 2-D Electrophoresis, Multiphor II Kits & Components and Accessories.
Info GE Healthcare, formerly Amersham BiosciencesGE Healthcare, formerly Amersham Biosciences
800 Centennial Avenue
PO Box 1327
Piscataway, NJ 08855-1327
USA


For GE Healthcare contacts in other countries
please click here.


Call GE Healthcare, formerly Amersham Biosciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-461-9198
Customer Service: 732-457-8000
Fax Number: 732-235-2201
Web Site: http://www.gelifesciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. EPH electrode, cathode from GE Healthcare, formerly Amersham Biosciences
2. Taq DNA Polymerase (cloned) from GE Healthcare, formerly Amersham Biosciences
3. Taq DNA Polymerase (Thermus aquaticus) from GE Healthcare, formerly Amersham Biosciences
4. Taq DNA Polymerase (Thermus aquaticus) from GE Healthcare, formerly Amersham Biosciences
5. One-Phor-All Buffer PLUS from GE Healthcare, formerly Amersham Biosciences
6. Ready-To-Go T4 DNA Ligase from GE Healthcare, formerly Amersham Biosciences
7. CodeLink Activated Slides from GE Healthcare, formerly Amersham Biosciences
8. Cell Proliferation Kit from GE Healthcare, formerly Amersham Biosciences
9. Zebrafish Vitellogenin ELISA System from GE Healthcare, formerly Amersham Biosciences
10. Carp Vitellogenin ELISA System from GE Healthcare, formerly Amersham Biosciences
11. Wheat Germ Agglutinin (WGA) PS SPA Imaging Bead from GE Healthcare, formerly Amersham Biosciences
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Biology Products:
(Date:2/16/2017)... 2017  Genos, a community for personal genetic ... received Laboratory Accreditation from the College of American ... laboratories that meet stringent requirements around quality, accuracy ... "Genos is committed to maintaining the ... honored to be receiving CAP accreditation," said ...
(Date:2/10/2017)... , Feb 10, 2017 Research ... report "Personalized Medicine - Scientific and Commercial Aspects" ... ... medicine. Diagnosis is integrated with therapy for selection of treatment ... early detection and prevention of disease in modern medicine. Biochip/microarray ...
(Date:2/8/2017)... Feb. 7, 2017 Report Highlights ... The global synthetic-biology market ... billion by 2021, growing at a compound annual growth rate ... overview of the global markets for synthetic biology. - Analyses ... 2016, and projections of compound annual growth rates (CAGRs) through ...
Breaking Biology News(10 mins):
(Date:2/23/2017)... TORONTO , Feb. 23, 2017 /PRNewswire/ - The ... Institute for Cancer Research (OICR) are pleased to report ... Series A financing, with Johnson & Johnson Innovation – ... investors include venture groups HealthCap, TPG Biotechnology Partners, and ... ...
(Date:2/23/2017)... Antonio, TX (PRWEB) , ... February 23, 2017 ... ... Drug Administration (FDA) de novo clearance to begin marketing the SPEAC® System, the ... indicated for adults at home or in healthcare facilities during periods of rest. ...
(Date:2/23/2017)... Feb. 23, 2017  Capricor Therapeutics, Inc. (NASDAQ: CAPR), a ... conditions, today announced that Linda Marbán, Ph.D, president and chief ... conferences: Cowen and Company 37th Annual ... ET Boston, MA ... am PT (12:00 pm ET) Dana Point, CA ...
(Date:2/22/2017)... ... February 22, 2017 , ... Kernel ... Kendall Research Systems, LLC (KRS) clinical development program. KRS is a neurotechnology ... for research and clinical applications. The terms of the transaction were not disclosed. ...
Breaking Biology Technology: