Navigation Links
ELISA, Microplate Coating from Affinity Life Sciences, Inc

ProductsELISA, Microplate Coating from Affinity Life Sciences, Inc
Company Affinity Life Sciences, Inc
Item ELISA, Microplate Coating
Price 
Description Affinity Life Sciences can provide custom microplate coating using advanced automated high throughput microplate processing equipment that dispenses and washes a variety of plate formats. We can also accommodate virtually any lot size of the following formats (with a volume range of 0.5-320 L):
  • 8 and 12 well strips
  • 96 well microplate
  • 384 well microplate
  • 1536 well microplate

The use of automated equipment provides a higher level of quality control during filling and washing procedures than manual or semi-manual microplate coating operations. Our quality control methods include validated microplate coating systems and the assurance that production runs will be accurate and reliable within lot and from lot-to-lot, which is essential for assays in drug discovery, toxicology, cell culture, research and clinical evaluations, diagnostic testing, and a host of other microplate studies that are critical to the end-user. These quality control measures will meet the strict demands of our medical device, biotechnology, pharmaceutical, and other life science customers.

Affinity Life Sciences can supply prepared microplates on a regularly scheduled basis for dependable delivery to your facility.

Info Affinity Life Sciences, IncAffinity Life Sciences, Inc
Milford Technology Center
528 Route 13 South
Suite 208
Milford, NH 03055
Customer Service: (603) 249-1644
Web Site: http://www.affinitylifesciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Bio-Stack Twister II Microplate Handler from BioTek Instruments
2. ELx50 Microplate Strip Washer from BioTek Instruments
3. Bio-Stack Microplate Stacker from BioTek Instruments
4. Precision XS Microplate Sample Processor from BioTek Instruments
5. Synergy HT Multi-Detection Microplate Reader from BioTek Instruments
6. NOVOstar Microplate Reader from BMG LABTECH
7. FLUOstar OPTIMA Multifunction Microplate Reader from BMG LABTECH
8. LUMIstar OPTIMA Microplate Reader from BMG LABTECH
9. Corning 96 Well Eia/Ria Microplate,Flat Bottom,Med Binding,Non-Sterile,W/O Lid from Sigma-Aldrich
10. Model 1575 Immunowash Microplate Washer from Bio-Rad
11. BD Falcon 1536-well Black/Clear Microplates from BD Biosciences - Discovery Labware
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2