Navigation Links
EDTA, disodium salt from GE Healthcare, formerly Amersham Biosciences

ProductsEDTA, disodium salt from GE Healthcare, formerly Amersham Biosciences
Company GE Healthcare, formerly Amersham Biosciences
Item EDTA, disodium salt
Price $105.00
Description EDTA, disodium salt, 1 kg. Ethylene diaminetetraacetic acid.Dihydrate. Assay: 99.0-101.0%, nuclease-free.Risks: 36, 37, 38 ; Safety Precautions: 22, 36, 37. Category: Nucleotides & Enzymes & Biochemicals, Ultrapure Biochemicals .
Info GE Healthcare, formerly Amersham BiosciencesGE Healthcare, formerly Amersham Biosciences
800 Centennial Avenue
PO Box 1327
Piscataway, NJ 08855-1327

For GE Healthcare contacts in other countries
please click here.

Call GE Healthcare, formerly Amersham Biosciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-461-9198
Customer Service: 732-457-8000
Fax Number: 732-235-2201
Web Site:
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. 0.5M EDTA, pH 7.2 from Upstate
2. EDTA, tetrasodium salt from GE Healthcare, formerly Amersham Biosciences
3. PlusOne EDTA, disodium salt from GE Healthcare, formerly Amersham Biosciences
4. EDTA, 0.5 M solution from GE Healthcare, formerly Amersham Biosciences
5. Taq DNA Polymerase (cloned) from GE Healthcare, formerly Amersham Biosciences
6. Taq DNA Polymerase (Thermus aquaticus) from GE Healthcare, formerly Amersham Biosciences
7. Taq DNA Polymerase (Thermus aquaticus) from GE Healthcare, formerly Amersham Biosciences
8. One-Phor-All Buffer PLUS from GE Healthcare, formerly Amersham Biosciences
9. Ready-To-Go T4 DNA Ligase from GE Healthcare, formerly Amersham Biosciences
10. CodeLink Activated Slides from GE Healthcare, formerly Amersham Biosciences
11. Cell Proliferation Kit from GE Healthcare, formerly Amersham Biosciences
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: