Navigation Links
Dr. P Set - Monkey (Cynomolgus) Normal Tissue: Small Intestine from BioChain

ProductsDr. P Set - Monkey (Cynomolgus) Normal Tissue: Small Intestine from BioChain
Company BioChain
Item Dr. P Set - Monkey (Cynomolgus) Normal Tissue: Small Intestine
Price $389.00
Description Dr. P Set from different Cynomolgus monkey normal tissues are available. More organs maybe available upon request. Customers can choose any two items from the whole set, and pay 70% of the whole set price. All Dr. P Set products are for research use only.
Info BioChainBioChain
BioChain Institute, Inc.
3517 Breakwater Avenue
Hayward, CA 94545 USA



Call BioChain to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-510-342-5324
Customer Service: 510.783.8588
Fax Number: 510.783.5386
Web Site: http://www.biochain.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Rhesus Monkey IFN Alpha from PBL InterferonSource
2. Monkey sICAM-1 ELISA Kit from Bender MedSystems
3. Monkey sE-selectin ELISA Kit from Bender MedSystems
4. Monkey sP-selectin ELISA Kit, Instant from Bender MedSystems
5. Monkey sP-selectin ELISA Kit from Bender MedSystems
6. Monkey sPECAM-1 ELISA Kit, Instant from Bender MedSystems
7. Monkey IL-2 ELISPOT Kit, With white/opague microtiter plates from Cell Sciences
8. Frozen Tissue Section Panel - Monkey (Cynomolgus) Normal Tissue, Multi-tissue I from BioChain
9. Paraffin Tissue Section Panel - Monkey (Simian) Normal Tissue, Multi-tissue I from BioChain
10. Frozen Tissue Section Panel - Monkey (Rhesus) Normal Tissue, Multi-tissue I from BioChain
11. Frozen Tissue Section Panel - Monkey (Cynomolgus) Normal Tissue, Multi-tissue III from BioChain
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2