Navigation Links
Denhardt's powder mixture (for 50X stock solution) from AppliChem GmbH

ProductsDenhardt's powder mixture (for 50X stock solution) from AppliChem GmbH
Company AppliChem GmbH
Item Denhardt's powder mixture (for 50X stock solution)
Price 
Description Denhardt's powder mixture (for 50X stock solution)
Info AppliChem GmbHAppliChem GmbH
AppliChem GmbH
Ottoweg 4
D-64291 Darmstadt
Germany
Tel: +49 (0)6151 / 9357-0
Fax: +49 (0)6151 / 9357-11

AppliChem Inc.
505 Highland Avenue
Cheshire, CT 06410 U.S.A.
Tel: (800) 620-7783
Fax: (800) 823-9903

Customer Service: +49 (0)6151 / 9357-0, 1 (800) 620-7783
Fax Number: +49 (0)6151 / 9357-11, 1 (800) 823-9903
Web Site: http://www.applichem.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Denhardts solution from Sigma-Aldrich
2. 50X Denhardts Solution from Invitrogen
3. GIBCO Dulbeccos Modified Eagle Medium (D-MEM); powder (high glucose) from Invitrogen
4. Tryptic Soy Agar powder (USP) from Mo Bio Laboratories, Inc.
5. GIBCO Iscoves Modified Dulbeccos Medium (IMDM); powder from Invitrogen
6. GIBCO RPMI Medium 1640; powder from Invitrogen
7. GIBCO RPMI Medium 1640; powder from Invitrogen
8. GIBCO Graces Insect Cell Culture Medium; powder from Invitrogen
9. GIBCO F-12 Nutrient Mixture (Ham) powder from Invitrogen
10. GIBCO Leibovitzs L-15 Medium powder from Invitrogen
11. Lactalbumin Hydrolysate powder (extra soluble) from Invitrogen
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Mouse monoclonal antibody raised against a partial recombinant QPCT. NCBI Entrez Gene ID = QPCT...
Biology Products:
(Date:11/18/2014)... --  News Highlights: , ... Partners Data Lake, an agile data and analytics ... allow researcher and clinicians to explore and develop ... of patients , The Partners Data Lake ... Partners system, breaking down physical barriers for collaboration ...
(Date:11/15/2014)... -- While we may still be a few years away from ... to gain instant access to all that ailed his patients, ... tablets for monitoring and measuring our health are cropping up ... a tad Orwellian to some, but a new survey suggests ... opportunities into their healthcare regime. These are some ...
(Date:11/10/2014)... appearing on U.S. store shelves in early 2010, and ... The small packets can be tossed into a washing ... or powder. The convenience, though, has come with risks ... at Nationwide Children,s Hospital found that from 2012 through ... children younger than 6 years of age swallowing, inhaling, ...
Breaking Biology News(10 mins):Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 2Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 3Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 4Partners HealthCare and EMC Unite to Solve Health Care's Toughest Challenges Using Big Data 5Americans May Be Ready for a Brave New World of Healthcare 2Americans May Be Ready for a Brave New World of Healthcare 3Americans May Be Ready for a Brave New World of Healthcare 4Study finds laundry detergent pods, serious poisoning risk for children 2
... For the first time, researchers have confirmed an association ... and abnormalities on brain MRI, according to a new ... The new study raises the possibility that a toxic ... body long after administration. Brain MRI exams ...
... Peterhans, a Roosevelt University professor and adjunct curator at ... mammals in Africa, has announced the discovery of four ... of the Democratic Republic of Congo. , The mammals ... led by the Wildlife Conservation Society (WCS) and in ...
... of millions of Americans, there,s no such thing as the ... hear a constant ringing, buzzing, hissing, humming or other noise ... be debilitating and life-altering. Now, University of Michigan ... what is going on inside their unquiet brains. The ...
Cached Biology News:Contrast agent linked with brain abnormalities on MRI 2Chicago scientist involved in discovery of 4 new mammal species in Democratic Republic of Congo 2U-M tinnitus discovery opens door to possible new treatment avenues 2U-M tinnitus discovery opens door to possible new treatment avenues 3
(Date:11/26/2014)... (PRWEB) November 25, 2014 Miles Holder, ... joined the Graphel Carbon Products team as Sales/Marketing Manager. ... marketing, and customer service for the graphite industry. , ... to our team,” stated Dave Trinkley, VP of Market ... wide range of experience in the graphite industry, along ...
(Date:11/26/2014)... 2014 Theravalues Corporation est fier d,annoncer ... européen au salon Hi Europe 2014 (du 2 ... Curcumine la plus biodisponible actuellement sur ... à des ingrédients approuvés par les règlements européens. ... présent dans la racine de curcuma ( Curcuma ...
(Date:11/24/2014)... Nov. 24, 2014  IGI Laboratories, Inc. (NYSE MKT: ... specialty generic pharmaceutical company, today announced it has submitted ... U.S. Food and Drug Administration (FDA), which brings the ... seven, with eighteen submissions now pending at the FDA. ... CEO of the Company, commented, "Our team here at ...
(Date:11/24/2014)... , November 24, 2014   ... online on ScienceDirect   Elsevier , a ... services, is pleased to announce the launch of the latest ... Current Opinion in Food Science . ... will provide specialists with a new platform to keep up-to-date ...
Breaking Biology Technology:Miles Holder Joins Graphel Corporation as Sales/Marketing Manager 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 2La curcumine présentant la plus haute biodisponibilité bientôt en vente en Europe 3IGI Laboratories, Inc. Announces ANDA Submission 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 2Elsevier Announces Launch of New Journal: Current Opinion in Food Science 3