Navigation Links
CyScribe First-Strand cDNA Labeling System - dUTP with CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences

ProductsCyScribe First-Strand cDNA Labeling System - dUTP with CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
Company GE Healthcare, formerly Amersham Biosciences
Item CyScribe First-Strand cDNA Labeling System - dUTP with CyScribe GFX Purification Kit
Price $1,142.00
Description CyScribe First-Strand cDNA Labeling System - dUTP with CyScribe GFX Purification Kit, 50 reactions. For the generation and purification of Cy3- and Cy5-labeled cDNA.Optimized reagents are packaged together for complete cDNA labeling and purification.Flexible and optimized protocols can be used for performing labeling reactions with either Cy3- or Cy5-labeled nucleotides.Reliable purification using the CyScribe GFX Kit, specifically designed for the purification of CyDye labeled cDNA, provides robust and consistent yields.Efficient incorporation of Cy3- or Cy5-labeled nucleotides using CyScribe labeling kit is accompanied with over 99.9% removal of unincorporated CyDye label and primers, yielding superior cDNA purity.Complete protocols for labeling, purification and quantitation of CyDye la. Category: Microarrays, Target Preparation, Labeling.
Info GE Healthcare, formerly Amersham BiosciencesGE Healthcare, formerly Amersham Biosciences
800 Centennial Avenue
PO Box 1327
Piscataway, NJ 08855-1327
USA


For GE Healthcare contacts in other countries
please click here.


Call GE Healthcare, formerly Amersham Biosciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-461-9198
Customer Service: 732-457-8000
Fax Number: 732-235-2201
Web Site: http://www.gelifesciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
2. CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
3. CyScribe Post-Labeling Kit with CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
4. CyScribe First-Strand cDNA Labeling Kit with CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
5. CyScribe First-Strand cDNA Labeling System - dCTP with CyScribe GFX Purification Kit from GE Healthcare, formerly Amersham Biosciences
6. Label IT siRNA Tracker Intracellular Localization Kit with TransIT-TKO Transfection Reagent (Cy5 Labeling Kit) from Mirus Bio Corporation
7. ELF® 97 Cytological Labeling Kit from CHEMICON
8. BioPrime Array CGH Genomic Labeling System from Invitrogen
9. BioPrime Plus Array CGH Indirect Genomic Labeling Module from Invitrogen
10. ULS cDNA Synthesis and Labeling Kit (with Cy3 and Cy5) from KREATECH Biotechnology
11. ULS cDNA Synthesis and Labeling Kit (with Biotin) from KREATECH Biotechnology
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... October 12, 2017 , ... ... genomics analysis platform specifically designed for life science researchers to analyze and ... researcher Rosalind Franklin, who made a major contribution to the discovery of ...
(Date:10/11/2017)... ... October 11, 2017 , ... Personal eye wash is a basic first aid supply for any ... So which eye do you rinse first if a dangerous substance enters both eyes? It’s ... Wash with its unique dual eye piece. , “Whether its dirt and debris, or ...
(Date:10/11/2017)... BioMarketing, a leading provider of patient support solutions, has announced ... network, which will launch this week. The VMS CNEs will ... to enhance the patient care experience by delivering peer-to-peer education ... professionals to help women who have been diagnosed and are ... ...
(Date:10/11/2017)... ... 11, 2017 , ... A new study published in Fertility ... fresh in vitro fertilization (IVF) transfer cycles. The multi-center matched cohort ... After comparing the results from the fresh and frozen transfer cohorts, the authors ...
Breaking Biology Technology: