Navigation Links
Custom Peptidomimetic Microarray from LC Sciences

ProductsCustom Peptidomimetic Microarray from LC Sciences
Company LC Sciences
Item Custom Peptidomimetic Microarray
Price 
Description Peptide microarrays containing peptidomimetics built on the flexible and powerful Paraflo microfluidic on-chip synthesis platform. These microarrays are available as part of our comprehensive Custom Peptide Microarray Service.

Custom Probe Content
Probe content is completely customer specified. Thousands of customer specified peptide sequences can be synthesized on-chip and LC Sciences can provide assistance with custom sequence design.

High-Throughput Format
Screening peptide on a microarray offers the opportunity to study thousands of specific sequences in a single experiment. One experiment using our high density peptide microarray is equivalent to 40 or more experiments using a 96-well plate. Perform multiple concentration bindings on the same chip to generate titration curves.

Paraflo Technology
These are not spotted arrays. The Paraflo microfluidic technology enables on-chip synthesis ensuring high probe quality, tight process control, and complete content flexibility. In addition, the microfluidic technology produces a uniform distribution of the sample solutions on the array and enhances binding reactions and stringency wash processes.

LC Sciences
LC Sciences is a genomics and proteomics company offering innovative, customizable, and comprehensive microarray services for nucleic acid/protein profiling and functional analysis, biomarker-discovery, novel drug screening, and the custom development of diagnostic devices. We provide unique one-stop products and services for assays of DNA, RNA, protein, enzymes, antibodies, or small molecules, as well as proven microfluidic technology and novel microarray chemistry for design of your miniaturized assay devices for diagnostics and biosensing applications.

Our microarray services include the use of custom synthesized microarrays based on the Paraflo on-chip synthesis technology which enables the total customization of content on each individual microarray. Our customers have the flexibility to use our standard probe content or their own custom designed probe content and to use probes of their chosen lengths and number of replicates. The Paraflo technology also provides the flexibility of synthesizing microarrays containing probes with modifications such as, 5-amino linker, phosphate, biotin, and various methylation or other types of modifications. Incorporation of modifications greatly increases the number of applications for these microarrays.

LC Sciences offers additional Paraflo technology derived products that serve customers needs for construction of biomolecular libraries containing up to millions of different biomolecules of defined sequences. These products significantly reduce the cost and increase the speed of highly multiplexing genome-scale experiments such as exploration of small RNAs and designer gene/DNA library synthesis.
Info LC SciencesLC Sciences
2575 W. Bellfort
Suite 270
Houston, TX 77054

Call LC Sciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-713-574-7399
Customer Service: (713) 664-7087 or Toll Free: (888) 528-8818
Fax Number: (713) 664-8181
Web Site: http://www.lcsciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Peptide Design and Custom Synthesis from Global Peptide Services, LLC.
2. Custom Arraying Service from Whatman, Inc
3. Custom 2-OMe RNA Aptamer Microarray from LC Sciences
4. Custom DNA Aptamer Microarray from LC Sciences
5. Custom 2-F RNA Aptamer Microarray from LC Sciences
6. Custom Peptide Microarray - Comprehensive Service from LC Sciences
7. Custom DNA Microarray from LC Sciences
8. Custom Antibody Production Services from Aves Labs, Inc.
9. EvoQuest ™ Custom Laboratory Services from Invitrogen
10. Custom Processing Service from Whatman, Inc
11. Custom Phosphopeptide Microarray from LC Sciences
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: