Navigation Links
Custom Peptide Microarray - Comprehensive Service from LC Sciences

ProductsCustom Peptide Microarray - Comprehensive Service from LC Sciences
Company LC Sciences
Item Custom Peptide Microarray - Comprehensive Service
Price 
Description LC Sciences provides a comprehensive service for custom peptide microarray experiments utilizing high density peptide microarrays synthesized on Paraflo microfluidic chips for quantitative assays using recombinant proteins/antibodies or serum samples. This comprehensive service includes assistance with your sequence designs, binding assays using sample(s) provided by you, single or dual color detection of the binding using a suitable method, image data processing, and signal data processing. Two-four weeks after receiving your sample(s), we send you a data summary report containing background subtraction, control and reference signal guided data processing, list of detected signals, and data averaging. We offer additional services for in-depth binding data analysis and curve analysis of quantitative measurements.

LC Sciences
LC Sciences is a genomics and proteomics company offering innovative, customizable, and comprehensive microarray services for nucleic acid/protein profiling and functional analysis, biomarker-discovery, novel drug screening, and the custom development of diagnostic devices. We provide unique one-stop products and services for assays of DNA, RNA, protein, enzymes, antibodies, or small molecules, as well as proven microfluidic technology and novel microarray chemistry for design of your miniaturized assay devices for diagnostics and biosensing applications.

Our microarray services include the use of custom synthesized microarrays based on the Paraflo on-chip synthesis technology which enables the total customization of content on each individual microarray. Our customers have the flexibility to use our standard probe content or their own custom designed probe content and to use probes of their chosen lengths and number of replicates. The Paraflo technology also provides the flexibility of synthesizing microarrays containing probes with modifications such as, 5-amino linker, phosphate, biotin, and various methylation or other types of modifications. Incorporation of modifications greatly increases the number of applications for these microarrays.

LC Sciences offers additional Paraflo technology derived products that serve customers needs for construction of biomolecular libraries containing up to millions of different biomolecules of defined sequences. These products significantly reduce the cost and increase the speed of highly multiplexing genome-scale experiments such as exploration of small RNAs and designer gene/DNA library synthesis.
Info LC SciencesLC Sciences
2575 W. Bellfort
Suite 270
Houston, TX 77054

Call LC Sciences to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-713-574-7399
Customer Service: (713) 664-7087 or Toll Free: (888) 528-8818
Fax Number: (713) 664-8181
Web Site: http://www.lcsciences.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Peptide Design and Custom Synthesis from Global Peptide Services, LLC.
2. Custom Arraying Service from Whatman, Inc
3. Custom 2-OMe RNA Aptamer Microarray from LC Sciences
4. Custom DNA Aptamer Microarray from LC Sciences
5. Custom 2-F RNA Aptamer Microarray from LC Sciences
6. Custom DNA Microarray from LC Sciences
7. Custom Antibody Production Services from Aves Labs, Inc.
8. EvoQuest ™ Custom Laboratory Services from Invitrogen
9. Custom Processing Service from Whatman, Inc
10. Custom Phosphopeptide Microarray from LC Sciences
11. Custom 60-mer Oligonucleotide Microarrays from Agilent Technologies
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial ... (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant ... Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: ... AAH15528 OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products:
(Date:3/30/2017)... 30, 2017  On April 6-7, 2017, Sequencing.com will ... hackathon at Microsoft,s headquarters in ... focus on developing health and wellness apps that provide ... the Genome is the first hackathon for personal ... largest companies in the genomics, tech and health industries ...
(Date:3/30/2017)... -- Trends, opportunities and forecast in this market to ... AFIS, iris recognition, facial recognition, hand geometry, vein recognition, ... industry (government and law enforcement, commercial and retail, health ... and by region ( North America , ... , and the Rest of the World) ...
(Date:3/28/2017)... -- The report "Video Surveillance Market by ... Devices), Software (Video Analytics, VMS), and Service (VSaaS, Installation ... 2022", published by MarketsandMarkets, the market was valued at ... reach USD 75.64 Billion by 2022, at a CAGR ... considered for the study is 2016 and the forecast ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... ... August 15, 2017 , ... JULABO USA introduces ... the new website makes it easy to navigate through the site whether you’re ... find detailed product information, educational industry content and visit the company’s social media ...
(Date:8/11/2017)... San Antonio, Texas (PRWEB) , ... August 11, 2017 , ... ... launching a rebranding campaign this month that will incorporate important key elements including a ... to thank the community that has supported them, Bill Miller has partnered with the ...
(Date:8/10/2017)... ... 09, 2017 , ... The era of using extracellular vesicles ... team at Capricor Therapeutics, Inc. utilized a cardiosphere-derived stem-like cell culturing process to ... Travis Antes, head of analytical development at Capricor Therapeutics Inc., will be the ...
(Date:8/10/2017)... ... August 10, 2017 , ... ... Kinokuniya Company Ltd. as its exclusive sales representative for SPIE Journals in Japan. ... the SPIE Digital Library in Japan. , “We look forward to expanding our ...
Breaking Biology Technology: