Navigation Links
Corning brand cover glass squares, 0.16 to 0.19mm thick from Sigma-Aldrich

ProductsCorning brand cover glass squares, 0.16 to 0.19mm thick from Sigma-Aldrich
Company Sigma-Aldrich
Item Corning brand cover glass squares, 0.16 to 0.19mm thick
Price 
Description These 25x25 square No.1 Corning cover glasses are made from No. 0211 zinc titania glass and are 0.16 to 0.19mm thick.
• Approx. Pcs Oz : 102
Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Corning Proculture Spinner Flask,15L,Vertical S/Arm, No. Of S/A 4,Cent Neck 100mm from Sigma-Aldrich
2. Corning Gaps Ii Bar-Coded Coated Slides from Sigma-Aldrich
3. Corning Petri Dish, 60 X 15 mm, Tc -Treated, Sterile from Sigma-Aldrich
4. Corning Roller Bottle Easy Grip Caps, Sterile from Sigma-Aldrich
5. Corning Cryo Vial Rack, PC, Holds 30 Self-Standing Vials, Non-Sterile from Sigma-Aldrich
6. Corning Resuable Pp Vial Rack, Non-Sterile, 50 Positions, Self Locking Design from Sigma-Aldrich
7. Corning Cryo Vial Rack & Tray, PC,Holds 30 Self-Standing Vial In Bath,Non-Sterile from Sigma-Aldrich
8. Corning Cryo Box, 81 Position, 4-5 ml, Non-Sterile from Sigma-Aldrich
9. Corning Cryo Box For Internal Thread Vials Only,100 Position,1-2 ml,Non-Sterile from Sigma-Aldrich
10. 801 Rotor System with 305/315, 6 50 ml Falcon/Corning from Thermo Scientific
11. 809 Rotor System with 302/668, 12 15 ml Falcon/Corning from Thermo Scientific
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: