Navigation Links
Cleland’s Reagent, Molecular Biology Grade from Calbiochem

ProductsCleland’s Reagent, Molecular Biology Grade from Calbiochem
Company Calbiochem
Item Cleland’s Reagent, Molecular Biology Grade
Price $35.00
Description 

1,4-Dithiothreitol
DTT

White crystalline solid. PACKAGED UNDER INERT GAS. Purity: ≥99% by titration. Contaminants: DNases, proteases, RNases: none detected. Absorbance (100 mM, 1 cm, 260 nm): ≤0.500; (100 mM, 1 cm, 280 nm): ≤0.100. Heavy metals: ≤0.001%. Soluble in H2O. RTECS EK1610000, CAS 3483-12-3, M.W. 154.2.

Info CalbiochemCalbiochem
Calbiochem, A Brand of EMD Biosciences, Inc.
10394 Pacific Center Court
San Diego, CA 92121
USA

Customer Service:
(800) 854-3417
(858) 450 9600

Tech Support: 800-628-8470
Fax Number:
(800) 776-0999
(858) 453 3552

Web Site: http://www.calbiochem.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Cleland’s Reagent from Calbiochem
2. Cleland’s Reagent, ULTROL® Grade from Calbiochem
3. Cleland’s Reagent from Calbiochem
4. Cleland’s REDUCTACRYL™ Reagent from Calbiochem
5. Mts-Atf-Biotin Label Transfer Reagent, 5 mg from Pierce Biotechnology, Inc.
6. Mts-Atf-LC-Biotin Label Transfer Reagent, 5 mg. from Pierce Biotechnology, Inc.
7. Coating-3 Reagent, 35mL from Caliper Life Sciences
8. Blocking Reagent, TBS with 1% BSA from Bethyl Laboratories
9. SYBR Green II RNA gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)
10. SYBR Green II RNA gel stain*10,000X concentrate in DMSO* from Molecular Probes (Invitrogen)
11. SYBR Green II RNA gel stain*10,000X concentrate in DMSO**special packaging* from Molecular Probes (Invitrogen)
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Biology Products:
(Date:3/30/2017)... ANGELES , March 30, 2017  On April ... Hack the Genome hackathon at Microsoft,s ... exciting two-day competition will focus on developing health and ... Hack the Genome is the ... been tremendous. The world,s largest companies in the genomics, ...
(Date:3/28/2017)... India , March 28, 2017 ... IP, Biometrics), Hardware (Camera, Monitors, Servers, Storage Devices), Software ... Vertical, and Region - Global Forecast to 2022", published ... Billion in 2016 and is projected to reach USD ... between 2017 and 2022. The base year considered for ...
(Date:3/23/2017)... The report "Gesture Recognition and Touchless Sensing Market by ... Global Forecast to 2022", published by MarketsandMarkets, the market is expected to be ... 2017 and 2022. Continue Reading ... ... ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... , ... October 12, 2017 , ... ... Vilnius, Lithuania, announced today that they have entered into a multiyear collaboration to ... provide CRISPR researchers with additional tools for gene editing across all applications. , ...
(Date:10/12/2017)... ... 12, 2017 , ... AMRI, a global contract research, development ... patient outcomes and quality of life, will now be offering its impurity solutions ... new regulatory requirements for all new drug products, including the finalization of ICH ...
(Date:10/11/2017)... ... October 11, 2017 , ... The CRISPR-Cas9 system ... experiments and avoiding the use of exogenous expression plasmids. The simplicity of programming ... systematic gain-of-function studies. , This complement to loss-of-function studies, such as with ...
(Date:10/11/2017)... , ... October 11, 2017 , ... ... announced today it will be hosting a Webinar titled, “Pathology is going digital. ... Associates , on digital pathology adoption best practices and how Proscia improves lab ...
Breaking Biology Technology: