Navigation Links
Chicken Anti-Ras-related C3 botulinum toxin substrate 1 Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.

ProductsChicken Anti-Ras-related C3 botulinum toxin substrate 1 Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
Company GenWay Biotech, Inc.
Item Chicken Anti-Ras-related C3 botulinum toxin substrate 1 Polyclonal Antibody, Unconjugated
Price $185.00
Description Ras-related C3 botulinum toxin substrate 1
Info GenWay Biotech, Inc.GenWay Biotech, Inc.
6777 Nancy Ridge Drive
San Diego, CA 92121
Customer Service: 858-458-0866
Fax Number: 858-458-0833
Web Site: http://www.genwaybio.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Chicken Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
2. Chicken Anti-UCK2 Polyclonal Antibody, Unconjugated from Abcam
3. Chicken Anti-Corticoliberin Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
4. Chicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Rhodamine Conjugated from Biomeda Corporation
6. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Biotin Conjugated from Biomeda Corporation
7. Chicken Anti-Human Stomatin-like 2 (STOML2) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
8. Chicken Anti-Human DNA-directed RNA Polymerase II 7.6 Kd Polypeptide (POLR2L) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Chicken Anti-Polymerase (RNA) II (DNA directed) polypeptide L Antibody, Unconjugated from CHEMICON
10. Chicken Anti-Rab GDP dissociation inhibitor beta Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
11. Chicken Anti-Human Complement Component C4c Antibody, Unconjugated from CEDARLANE Laboratories Limited
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial ... (AAH15528, 56 a.a. ~ 145 a.a) partial recombinant ... Sequence: EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: ... AAH15528 OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
Biology Products:
(Date:3/30/2017)... 30, 2017  On April 6-7, 2017, Sequencing.com will ... hackathon at Microsoft,s headquarters in ... focus on developing health and wellness apps that provide ... the Genome is the first hackathon for personal ... largest companies in the genomics, tech and health industries ...
(Date:3/30/2017)... -- Trends, opportunities and forecast in this market to ... AFIS, iris recognition, facial recognition, hand geometry, vein recognition, ... industry (government and law enforcement, commercial and retail, health ... and by region ( North America , ... , and the Rest of the World) ...
(Date:3/28/2017)... -- The report "Video Surveillance Market by ... Devices), Software (Video Analytics, VMS), and Service (VSaaS, Installation ... 2022", published by MarketsandMarkets, the market was valued at ... reach USD 75.64 Billion by 2022, at a CAGR ... considered for the study is 2016 and the forecast ...
Breaking Biology News(10 mins):
(Date:8/15/2017)... ... August 15, 2017 , ... JULABO USA introduces ... the new website makes it easy to navigate through the site whether you’re ... find detailed product information, educational industry content and visit the company’s social media ...
(Date:8/11/2017)... San Antonio, Texas (PRWEB) , ... August 11, 2017 , ... ... launching a rebranding campaign this month that will incorporate important key elements including a ... to thank the community that has supported them, Bill Miller has partnered with the ...
(Date:8/10/2017)... ... 09, 2017 , ... The era of using extracellular vesicles ... team at Capricor Therapeutics, Inc. utilized a cardiosphere-derived stem-like cell culturing process to ... Travis Antes, head of analytical development at Capricor Therapeutics Inc., will be the ...
(Date:8/10/2017)... ... August 10, 2017 , ... ... Kinokuniya Company Ltd. as its exclusive sales representative for SPIE Journals in Japan. ... the SPIE Digital Library in Japan. , “We look forward to expanding our ...
Breaking Biology Technology: