Navigation Links
Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc

ProductsChicken Anti-HOXC11 Polyclonal Antibody, Unconjugated from ProSci, Inc
Company ProSci, Inc
Item Chicken Anti-HOXC11 Polyclonal Antibody, Unconjugated
Price $315.00
Description HOXC11 Antibody
Info ProSci, IncProSci, Inc
ProSci Incorporated
12170 Flint Place
Poway, CA 92064
Customer Service: (888) 513-9525

(858) 513-2638
Fax Number: (858) 513-2692
Web Site: http://www.prosci-inc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Chicken Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
2. Chicken Anti-UCK2 Polyclonal Antibody, Unconjugated from Abcam
3. Chicken Anti-Corticoliberin Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
4. Chicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated from Abcam
5. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Rhodamine Conjugated from Biomeda Corporation
6. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Biotin Conjugated from Biomeda Corporation
7. Chicken Anti-Human Stomatin-like 2 (STOML2) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
8. Chicken Anti-Human DNA-directed RNA Polymerase II 7.6 Kd Polypeptide (POLR2L) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
9. Chicken Anti-Polymerase (RNA) II (DNA directed) polypeptide L Antibody, Unconjugated from CHEMICON
10. Chicken Anti-Rab GDP dissociation inhibitor beta Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
11. Chicken Anti-Human Complement Component C4c Antibody, Unconjugated from CEDARLANE Laboratories Limited
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... a partial recombinant NFKBIB. Immunogen: ... partial recombinant protein with GST tag. ... Accession: BC015528 Protein Accession ... 604495, GeneID: 4793 ...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:7/20/2017)... , July 20, 2017 Delta (NYSE: DAL ... board any Delta aircraft at Reagan Washington National Airport (DCA). ... Delta launches biometrics to ... Delta,s biometric ... Sky Club is now integrated into the boarding process to allow ...
(Date:5/16/2017)... 2017  Veratad Technologies, LLC ( www.veratad.com ), an ... identity verification solutions, announced today they will participate as ... 15 thru May 17, 2017, in Washington ... Center. Identity impacts the lives of ... quickly evolving digital world, defining identity is critical to ...
(Date:4/18/2017)... Inc., a global expert in SoC-based imaging and computing solutions, has ... features the company,s hybrid codec technology. A demonstration utilizing TeraFaces ® ... be showcased during the upcoming Medtec Japan at Tokyo Big Sight ... Las Vegas Convention Center April 24-27. ... Click here for an image of the ...
Breaking Biology News(10 mins):
(Date:10/12/2017)... ... ... AMRI, a global contract research, development and manufacturing organization ... quality of life, will now be offering its impurity solutions as a stand-alone ... for all new drug products, including the finalization of ICH M7 earlier this ...
(Date:10/11/2017)... USA (PRWEB) , ... October 11, 2017 , ... ComplianceOnline’s ... take place on 7th and 8th June 2018 in San Francisco, CA. The Summit ... as well as several distinguished CEOs, board directors and government officials from around the ...
(Date:10/11/2017)... ... October 11, 2017 , ... A new study published ... frozen and fresh in vitro fertilization (IVF) transfer cycles. The multi-center ... success. , After comparing the results from the fresh and frozen transfer cohorts, ...
(Date:10/10/2017)... ... ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. spent ... entitled “Stem Cells and Their Regenerative Powers,” was held on August 31st, 2017 ... joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic Surgery, Grossmont ...
Breaking Biology Technology: