Navigation Links
Chicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated from Abcam

ProductsChicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated from Abcam
Company Abcam
Item Chicken Anti-HADHSC Azide Free Polyclonal Antibody, Unconjugated
Price 
Description Chicken polyclonal to HADHSC - Azide free (Abpromise for all tested applications).
Antigen: Amino acids 57-314 of HADHSC
Entrez GeneID: 3033
Swiss Protein ID: Q16836
Info AbcamAbcam
332 Cambridge Science Park
Milton Road
Cambridge CB4 0FW
UK







Customer Service: +44 (0) 1223 472030
Fax Number: +44 (0) 1223 472038
Web Site: http://www.abcam.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Chicken Anti-GST Polyclonal Antibody, Unconjugated from Novus Biologicals
2. Chicken Anti-UCK2 Polyclonal Antibody, Unconjugated from Abcam
3. Chicken Anti-Corticoliberin Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
4. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Rhodamine Conjugated from Biomeda Corporation
5. Rabbit Anti-Chicken IgY, IgG F(ab)2 fragment Antibody, Biotin Conjugated from Biomeda Corporation
6. Chicken Anti-Human Stomatin-like 2 (STOML2) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
7. Chicken Anti-Human DNA-directed RNA Polymerase II 7.6 Kd Polypeptide (POLR2L) Polyclonal Antibody, Unconjugated from Lifespan Biosciences
8. Chicken Anti-Polymerase (RNA) II (DNA directed) polypeptide L Antibody, Unconjugated from CHEMICON
9. Chicken Anti-Rab GDP dissociation inhibitor beta Polyclonal Antibody, Unconjugated from GenWay Biotech, Inc.
10. Chicken Anti-Human Complement Component C4c Antibody, Unconjugated from CEDARLANE Laboratories Limited
11. Chicken Anti-HSPBP1 Polyclonal Antibody, Unconjugated from ProSci, Inc
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: