Navigation Links
CORNING 1536 WELL PLATE,2UL,WHITE,NON-TREATED,NON STERILE from Sigma-Aldrich

ProductsCORNING 1536 WELL PLATE,2UL,WHITE,NON-TREATED,NON STERILE from Sigma-Aldrich
Company Sigma-Aldrich
Item CORNING 1536 WELL PLATE,2UL,WHITE,NON-TREATED,NON STERILE
Price 
Description White walled plates enhance luminescent signals and have low background luminescence and fluorescence • Not treated (or medium binding) polystyrene surface is hydrophobic in nature and binds biomolecules through passive interactions • Is suitable primarily for the immobilization of large molecules, such as antibodies, that have large hydrophobic regions that can interact with the surface • Untreated microplates have a binding capacity of approximately 100 to 200ng IgG/cm • Recommended working volume of up to 1.5L • Flat bottoms with no lids (Top plate serves as lid for plate underneath.) • The 2L microplate conforms to standard microplate footprint and dimensions • The plates are demarcated in a 8 x 12 array with each square containing 16 wells • Eight extra wells on both the left and right sides of the plate that can be used to run controls • Series of notches that allow stacked plates to be easily separated from one another
Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CORNING CELL LIFTER,STERILE from Sigma-Aldrich
2. CORNING SPATULA, TAPERED BLADE/SPOON, STERILE from Sigma-Aldrich
3. CORNING CELL SCRAPER, SMALL ,STERILE from Sigma-Aldrich
4. CORNING MICROSPATULA, ROUNDED END/SCOOP from Sigma-Aldrich
5. CORNING SPATULA, SMALL SPOON/SPOON, STERILE from Sigma-Aldrich
6. CORNING CELL SCRAPER, LARGE, STERILE from Sigma-Aldrich
7. CORNING SPATULA, ROUND END/SPOON, STERILE from Sigma-Aldrich
8. CORNING PETRI DISH, 100 X 20 MM, PS, ULTRA LOW BINDING, STERILE from Sigma-Aldrich
9. CORNING ROLLER BOTTLE WITH CELLBIND, 1700CM2, STERILE from Sigma-Aldrich
10. CORNING ROLLER BOTTLES, 490 CM2, PS CAP, PLUG SEAL, STERILE from Sigma-Aldrich
11. CORNING 1700CM2 ROLLER BOTTLE, EASY GRIP CAP, GRADUATED, STERILE from Sigma-Aldrich
... Lines ,High Quality, Functionally-Validated, Ion Channel Cell ... for having a critical role in nerve ... key function in pain, CNS and the ... been investigated in therapeutic areas, such as ...
Mouse monoclonal antibody raised against a partial recombinant CHD8. NCBI Entrez Gene ID = CHD8...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products:
(Date:4/11/2017)... -- NXT-ID, Inc. (NASDAQ:   NXTD ) ("NXT-ID" ... of independent Directors Mr. Robin D. Richards and ... furthering the company,s corporate governance and expertise. ... Gino Pereira , Chief Executive Officer ... guidance and benefiting from their considerable expertise as we move ...
(Date:4/4/2017)... , April 4, 2017   EyeLock LLC , ... that the United States Patent and Trademark Office (USPTO) ... covers the linking of an iris image with a ... and represents the company,s 45 th issued patent. ... is very timely given the multi-modal biometric capabilities that ...
(Date:3/29/2017)... March 29, 2017  higi, the health IT company ... North America , today announced a Series ... acquisition of EveryMove. The new investment and acquisition accelerates ... tools to transform population health activities through the collection ... higi collects and secures data today on ...
Breaking Biology News(10 mins):
(Date:10/11/2017)... (PRWEB) , ... October 11, 2017 , ... ... pathology, announced today it will be hosting a Webinar titled, “Pathology is going ... Pathology Associates , on digital pathology adoption best practices and how Proscia improves ...
(Date:10/11/2017)... ... 11, 2017 , ... Singh Biotechnology today announced that the ... its novel anti-STAT3 (Signal Transducer and Activator of Transcription 3) B VHH13 single ... the cell membrane and bind intracellular STAT3 and inhibit its function. Dysregulation of ...
(Date:10/10/2017)... , Oct. 10, 2017 International research firm Parks Associates ... will speak at the TMA 2017 Annual Meeting , October 11 ... in the residential home security market and how smart safety and security ... Parks Associates: ... "The residential security ...
(Date:10/9/2017)... ... October 09, 2017 , ... The award-winning American Farmer television series will ... American Farmer airs Tuesdays at 8:30aET on RFD-TV. , With global population estimates ... of how to continue to feed a growing nation. At the same time, many ...
Breaking Biology Technology: