Navigation Links
CERTOMAT R from Sartorius AG

ProductsCERTOMAT R from Sartorius AG
Company Sartorius AG
Item CERTOMAT R
Price 
Description 
  • Fixed clamp trays and universal trays make vessel placement easy
  • Magnetic drive
  • Shaking speed: 40 - 350 rpm
  • 25 mm amplitude
  • Clamps for Erlenmeyer flasks 25 ml to 2000 ml, including Fernbach flasks
  • Hinged racks for test tubes and centrifugation tubes
Info Sartorius AGSartorius AG
Weender Landstrasse 94-108
D-37075 Goettingen, Germany
Phone: +49.551.308.0
Fax: +49.551.308.3289

Sartorius North America, Inc.
Biolab - Biotechnology Division
131 Heartland Blvd.
Edgewood, NY 11717
USA
Toll-free: 877-452-2345
Fax: 631-253-5460


Customer Service: +49.551.308.0
Fax Number: +49.551.308.3289
Web Site: http://www.sartorius.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. CERTOMAT IS from Sartorius AG
2. CERTOMAT RM from Sartorius AG
3. CERTOMAT U from Sartorius AG
4. VoluPAC Tubes from Sartorius AG
5. Vivaclear Centrifugal Filters from Sartorius AG
6. Vivaspin 2 (10,000 MWCO Hydrosart) from Sartorius AG
7. Sartolab P 20 Disposable Pressure Filter, 0.2 m, sterile, single packed from Sartorius AG
8. Microsart e.motion Membrane Filters from Sartorius AG
9. Microsart e.motion Membrane Filters from Sartorius AG
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:5/16/2017)... DALLAS , May 16, 2017   ... for health organizations, and MD EMR Systems ... certified development partner for GE, have established a ... Patient Portal product and the GE Centricity™ products, ... Centricity EMR. These new integrations ...
(Date:4/17/2017)... , April 17, 2017 NXT-ID, Inc. ... company, announces the filing of its 2016 Annual Report on Form ... Exchange Commission. ... Form 10-K is available in the Investor Relations section of the ... on the SEC,s website at http://www.sec.gov . 2016 ...
(Date:4/11/2017)... , April 11, 2017 No two ... researchers at the New York University Tandon School ... Engineering have found that partial similarities between prints ... used in mobile phones and other electronic devices ... The vulnerability lies in the fact that ...
Breaking Biology News(10 mins):
(Date:5/24/2017)... As Ebola resurfaces in the Democratic ... suspected cases now reported, a new analysis of the Ebola ... correlation between the 2014 and 2017 outbreaks of the disease.  ... 2012-13, which preceded the 2014 outbreak. An analysis of the ... counts in 2014-15, which again precedes the current outbreak in ...
(Date:5/23/2017)... , ... May 22, 2017 , ... ... in a row in the Aragon Research Globe™ for Corporate Learning, 2017. , ... industry direction and market demand, and effectively perform against those strategies. NetDimensions’ ranking ...
(Date:5/23/2017)... (PRWEB) , ... May 23, 2017 , ... Bacterial biofilms, ... polymeric molecules, can cause diverse pathologies ranging from food poisoning and catheter infections to ... biofilms is in the tens of billions of dollars per year, there is currently ...
(Date:5/22/2017)... ... 2017 , ... Cancer diagnostics and pathology workflow solution provider ... Association for Pathology Informatics Annual Summit at the Wyndham Grand Hotel ... Diagnostic Cockpit and Consultation Portal, Inspirata will present research it led to help ...
Breaking Biology Technology: