Navigation Links
BioEditor from San Diego Super Computer Center - Bioeditor

ProductsBioEditor from San Diego Super Computer Center - Bioeditor
Company San Diego Super Computer Center - Bioeditor
Item BioEditor
Price Inquire
Description Overview: Once a macromolecular structure has been determined, the challenge is to communicate that information to a widely diverse audience of scientists, educators and students. Current options include the printed literature and dissemination over the Internet, either via online journals or directly on personal web pages. Printed literature has the advantage of wide acceptance and availability, but presents static images. Web pages can be powerful, but lack a uniform format. Furthermore, any dynamic images that are presented are subject to the whims of the providers of the browsers and plug-ins that are required to view them. At the University of California, San Diego and the Scripps Institute, we are developing the BioEditor as a tool to bridge the gap between the printed literature and current Internet presentation formats. It is a standalone Windows application that can be used to prepare and present structure annotations containing formatted text, graphics, sequence data, and interactive molecular views. This presentation will summarize the features of BioEditor and provide an overview of a series of annotations that have been developed on DNA-protein complexes.
Info San Diego Super Computer Center - Bioeditor
Web Site: http://bioeditor.sdsc.edu/index.shtml
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Superfusion System, Raiteris Method from myNeuroLab.com
2. Product Information Request - SuperSignal West Pico COMPLETE Biotinylated Protein Detection Kit from Pierce Biotechnology, Inc.
3. SuperScript II RNase H- Reverse Transcriptase from Invitrogen
4. SuperScript II RNase H- Reverse Transcriptase from Invitrogen
5. SuperScript III RNase H- Reverse Transcriptase from Invitrogen
6. Super Cooling Coil, Trans-Blot cell from Bio-Rad
7. SuperFreeze Peroxidase Conjugate Stabilizer from Pierce Biotechnology, Inc.
8. Supercritical fluid chromatography and extraction systems (SFC/SFE) from JASCO
9. SuperScript Plasmid System and MAX Efficiency DH10BCompetent Cells from Invitrogen
10. luciferase Assay Kit, SuperLight from BioAssay Systems
11. Supercoiled DNA Ladder from Invitrogen
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products:
(Date:11/24/2016)... Nov. 23, 2016 Cercacor today introduced Ember ... their trainers non-invasively measure hemoglobin, Oxygen Content, ... and Respiration Rate in approximately 30 seconds. Smaller than ... and immediate access to key data about their bodies ... training regimen. Hemoglobin carries oxygen to ...
(Date:11/21/2016)... VILNIUS, Lithuania , Nov. 21, 2016 /PRNewswire/ ... identification and object recognition technologies, today announced that ... for smart cards was submitted for the ... and successfully passed all the mandatory steps of ... III evaluation is a continuing test of fingerprint ...
(Date:11/17/2016)... 17, 2016  AIC announces that it has just released a new white paper ... high-performance scale-out plus high speed data transfer storage solutions. Photo - ... ... ... Setting up a high performance computing or HPC ...
Breaking Biology News(10 mins):
(Date:11/30/2016)... , Nov. 30, 2016 /PRNewswire/ - Portage Biotech Inc. ... Exchange: PBT.U), is excited to announce the formation ... on developing preclinical ophthalmology assets through proof of ... anti-inflammatory created by Portage Pharmaceuticals Limited and being ... ocular surface and anterior segment diseases. This agent ...
(Date:11/30/2016)...  Tempus, a technology company focused on supporting ... Cancer Center have partnered to better determine which ... treatment based on next generation genomic and transcriptomic ... research collaboration, Tempus will provide sequencing and analysis ... to Penn. Utilizing next-generation sequencing, machine learning and ...
(Date:11/30/2016)... --  Merck , a leading science and technology company, ... of agreements with Evotec AG, whereby Evotec AG will ... such as CRISPR and shRNA libraries. Combining access to ... pathway to explore and identify new drug targets. ... targets, a process that can be time- and labor-intensive," ...
(Date:11/30/2016)... Park, North Carolina (PRWEB) , ... November 30, 2016 , ... ... approved the names and symbols for four elements: nihonium (Nh), moscovium (Mc), tennessine ... a 5-month period of public review, the names earlier proposed by the discoverers have ...
Breaking Biology Technology: