Navigation Links
Big CHAP, Deoxy from Calbiochem

ProductsBig CHAP, Deoxy from Calbiochem
Company Calbiochem
Item Big CHAP, Deoxy
Price $64.00
Description 

N,N-bis-(3-D-Gluconamidopropyl)deoxycholamide

White solid. HYGROSCOPIC. A non-ionic detergent analog of CHAPS and CHAPSO. Has reduced electrostatic interactions that do not interfere in anion exchange chromatography on DEAE-cellulose. Aggregation number: 8-16. Purity: ≥95% by HPLC. Soluble in H2O. Aggregation number 8 - 16, CMC 1.1 - 1.4 mM. CAS 86303-23-3, M.W. 862.1.

Info CalbiochemCalbiochem
Calbiochem, A Brand of EMD Biosciences, Inc.
10394 Pacific Center Court
San Diego, CA 92121
USA

Customer Service:
(800) 854-3417
(858) 450 9600

Tech Support: 800-628-8470
Fax Number:
(800) 776-0999
(858) 453 3552

Web Site: http://www.calbiochem.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Cleland’s Reagent from Calbiochem
2. Cleland’s Reagent, ULTROL® Grade from Calbiochem
3. Cleland’s Reagent, Molecular Biology Grade from Calbiochem
4. Cleland’s Reagent from Calbiochem
5. Cleland’s REDUCTACRYL™ Reagent from Calbiochem
6. Freunds Complete Adjuvant, Modified, Mycobacterium butyricum from Calbiochem
7. Freunds Incomplete Adjuvant, Modified from Calbiochem
8. Cell invasion Fluorometric (green) Assay Kit, InnoCyte™ from Calbiochem
9. PARP Cleavage Detection Kit from Calbiochem
10. Rabbit Anti-Wilms Tumor Protein Polyclonal Antibody, Unconjugated from Calbiochem
11. Nuclear Matrix Protein ELISA Kit from Calbiochem
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
... Mouse polyclonal antibody raised against ... Immunogen: PPP4C ... a.a) partial recombinant protein with ... Accession Number: NM_002720 ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:4/28/2016)... , April 28, 2016 First quarter ... (139.9), up 966% compared with the first quarter of 2015 ... totaled SEK 589.1 M (loss: 18.8) and the operating margin was ... (loss: 0.32) Cash flow from operations was SEK 249.9 ... 2016 revenue guidance is unchanged, SEK 7,000-8,500 M. The ...
(Date:4/19/2016)... , UAE, April 20, 2016 ... implemented as a compact web-based "all-in-one" system solution for ... biometric fingerprint reader or the door interface with integration ... modern access control systems. The minimal dimensions of the ... readers into the building installations offer considerable freedom of ...
(Date:4/14/2016)... , April 14, 2016 ... Malware Detection, today announced the appointment of Eyal ... new role. Goldwerger,s leadership appointment comes at ... heels of the deployment of its platform at several ... biometric technology, which discerns unique cognitive and physiological factors, ...
Breaking Biology News(10 mins):
(Date:6/27/2016)... ... June 27, 2016 , ... Rolf K. Hoffmann, former ... of the University of North Carolina Kenan-Flagler Business School effective June ... UNC Kenan-Flagler, with a focus on the school’s international efforts, leading classes and ...
(Date:6/24/2016)... Brooklyn, NY (PRWEB) , ... June 24, 2016 , ... ... 15mm, machines such as the Cary 5000 and the 6000i models are higher end ... height is the height of the spectrophotometer’s light beam from the bottom of the ...
(Date:6/23/2016)... 2016 /PRNewswire/ - FACIT has announced the creation ... biotechnology company, Propellon Therapeutics Inc. ("Propellon" or "the ... a portfolio of first-in-class WDR5 inhibitors for the ... WDR5 represent an exciting class of therapies, possessing ... for cancer patients. Substantial advances have been achieved ...
(Date:6/23/2016)... , June, 23, 2016  The Biodesign Challenge (BDC), ... new ways to harness living systems and biotechnology, announced ... (MoMA) in New York City . ... participating students, showcased projects at MoMA,s Celeste Bartos Theater ... Antonelli , MoMA,s senior curator of architecture and design, ...
Breaking Biology Technology: