Navigation Links
Beacon 2000 Lamps from Invitrogen

ProductsBeacon 2000 Lamps from Invitrogen
Company Invitrogen
Item Beacon 2000 Lamps
Price 
Description Quartz-Halogen, 100 W, High Intensity
Info InvitrogenInvitrogen
Invitrogen Corporation
1600 Faraday Ave.
Carlsbad, CA 92008

Call Invitrogen to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-521-4270
Customer Service: 800-955-6288
Tech Support: 800-955-6288 ext. 2
Fax Number: 760-603-7229
Web Site: http://www.invitrogen.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Beacon 2000 Data Mgmt Software from Invitrogen
2. Standard Beacon 2000 U.S. Extended Warranty (1 year) from Invitrogen
3. Beacon 2000 Chamber (6mm, Minimum Vol - 100 uL) from Invitrogen
4. Beacon 2000 Test Tubes, 6x50mm from Invitrogen
5. Beacon 2000 One-Step FP Std from Invitrogen
6. Beacon 2000 Test Tubes,10x75mm from Invitrogen
7. Beacon 2000 Test Tubes,10x75mm from Invitrogen
8. Beacon Designer from PREMIER Biosoft International
9. Blasticidin S HCl from Invitrogen
10. EBY100 S. cerevisiae Strain from Invitrogen
11. Anti-JIP 1 / 2 (SH3) Polyclonal Antibody, Unconjugated, Clone ZMD.177 from Invitrogen
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Biology Products:
(Date:6/20/2016)... 2016 Securus Technologies, a leading provider ... public safety, investigation, corrections and monitoring announced that ... has secured the final acceptance by all three ... Access Systems (MAS) installed. Furthermore, Securus will have ... installed by October, 2016. MAS distinguishes between legitimate ...
(Date:6/15/2016)... York , June 15, 2016 ... new market report titled "Gesture Recognition Market by Application ... Forecast, 2016 - 2024". According to the report, the  ... 11.60 billion in 2015 and is estimated to ... USD 48.56 billion by 2024.  Increasing ...
(Date:6/9/2016)... Paris Police Prefecture and ... ensure the safety of people and operations in several locations ... Teleste, an international technology group specialised in broadband ... its video security solution will be utilised by ... across the country. The system roll-out is scheduled for the ...
Breaking Biology News(10 mins):
(Date:6/23/2016)... , June 23, 2016 Apellis Pharmaceuticals, ... 1 clinical trials of its complement C3 inhibitor, ... and multiple ascending dose studies designed to assess ... of subcutaneous injection in healthy adult volunteers. ... either as a single dose (ranging from 45 ...
(Date:6/23/2016)... -- Andrew D Zelenetz , ... Published recently in Oncology & ... Andrew D Zelenetz , discusses the fact ... placing an increasing burden on healthcare systems worldwide, ... the patents on many biologics expiring, interest in ...
(Date:6/23/2016)... ... June 23, 2016 , ... ClinCapture, the only ... Center and will showcase its product’s latest features from June 26 to June ... scientific poster on Disrupting Clinical Trials in The Cloud during the conference. ...
(Date:6/23/2016)... ... June 23, 2016 , ... Velocity Products, a division of ... and optimized exclusively for Okuma CNC machining centers at The International Manufacturing Technology ... among several companies with expertise in toolholding, cutting tools, machining dynamics and distribution, ...
Breaking Biology Technology: