Navigation Links
Bacterial Strain NM522, Glycerol Stock from Promega

ProductsBacterial Strain NM522, Glycerol Stock from Promega
Company Promega
Item Bacterial Strain NM522, Glycerol Stock
Price Inquire
Description NM522 contains an F episome, which is required for production of ssDNA and for blue/white color selection. To maintain the F, NM522 should be grown on minimal (M-9) medium.
Info PromegaPromega
2800 Woods Hollow Rd.
Madison, WI 53711-5399 USA
Customer Service: 800-356-9526
Tech Support: 1-800-356-9526
Fax Number: 800-356-1970
Web Site: http://www.promega.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Bacterial Cell Paste Production Services from ARVYS Proteins, Inc.
2. Protein Expression Service (Bacterial) from Exon BioSystems
3. Bacterial system service from Abgent
4. Bacterial Strain ES1301 mutS, Glycerol Stock (noncompetent) from Promega
5. Bacterial Strain BMH 71-18 mutS, Glycerol Stock (noncompetent) from Promega
6. Rabbit Anti-Bacterial HISTIDASE Polyclonal Antibody, Unconjugated from AbD Serotec
7. Chicken Anti-Bacterial ytzF Polyclonal Antibody, Unconjugated from Abcam
8. EBY100 S. cerevisiae Strain from Invitrogen
9. Mouse Anti-Yersinia pestis F1 Antigen EB Strain Monoclonal Antibody, Unconjugated, Clone YPF19 from Meridian Life Science, Inc.
10. Mechanical Cell Strain Instrument ST-160 Microscope Mountable from B-Bridge International
11. Mechanical Cell Strain Instrument STREX ST-195 Microscope Mountable from B-Bridge International
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... partial recombinant NFKBIB. Immunogen: ... recombinant protein with GST tag. ... BC015528 Protein Accession Number: ... GeneID: 4793 ...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products:
(Date:8/26/2020)... (PRWEB) , ... August 25, 2020 , ... ... and manufacturing solutions for drugs, biologics, cell and gene therapies, and consumer health ... 16th Annual PEGS Boston Virtual Conference & Expo, taking place between Aug. 31 ...
(Date:8/23/2020)... ... 21, 2020 , ... The August edition of Crystallography ... available on the company’s global website. Crystallography Times—an electronic newsletter published by Rigaku ... and crystallographic research. , The latest issue of Crystallography Times introduces the ...
(Date:8/21/2020)... ... August 19, 2020 , ... “How can we help?”, ... to Salivary Bioscience for more than twenty years. Together with Douglas Granger, Ph.D., ... Salivary Bioscience: Foundations of Interdisciplinary Saliva Research and Applications ," and Steven Granger, ...
Breaking Biology News(10 mins):
(Date:7/22/2020)... ... July 22, 2020 , ... Join experts from Reed ... Manager Regulatory Solutions, in a one hour live webinar on Thursday, August ... in China for drugs and medical devices. Specifically, for medical devices, the NMPA has ...
(Date:7/18/2020)... ... 2020 , ... “We are thrilled to deliver this new technology to the ... its kind on the market and we were pleased that the IFT jury recognized ... cultured ingredients, creating a natural way to extend the shelf life and improve the ...
(Date:7/18/2020)... , ... July 17, 2020 , ... ... consulting firm for the life sciences and food industries, is pleased to announce ... of Clinical Research – Business Development. , Charles is an accomplished and results-driven ...
(Date:7/10/2020)... ... July 09, 2020 , ... ... that Massachusetts Institute of Technology (MIT) has expanded the company’s exclusive license ... to move into the point-of-care diagnostic market, focusing initially on the SARS-CoV-2 ...
Breaking Biology Technology: