Navigation Links
Anti-Sheep/Goat Sac-Cel - Solid-phase Separation System from IDS Ltd

ProductsAnti-Sheep/Goat Sac-Cel - Solid-phase Separation System from IDS Ltd
Company IDS Ltd
Item Anti-Sheep/Goat Sac-Cel - Solid-phase Separation System
Price 
Description Sac-Cel (Second Antibody Coated CELlulose) was developed in the late 1960s by Wellcome Diagnostics of Dartford, Kent, one of the earliest commercial pioneers of immunoassay in the world. IDS acquired the product range in 1987. Sac-Cel rapidly found favour with researchers and clinical biochemists developing their own "in house" radioimmunoassays, and became a benchmark methodology for the separation of Bound from Free fractions (B/F) in RIA. When used in liquid phase immunoassays, Sac-Cel provides a ready-to-use solid-phase separation medium, fine enough to remain in suspension during pipetting stages, but delivering firmer pellets in much shortened centrifugation time. After incubation with primary antibody (in the absence of potentially interfering carrier serum) and tracer, Sac-Cel is added. Following a second incubation, the reaction volume is increased by dilution prior to a short, low speed spin (typically 2 minutes at just 1,000 g). This effectively washes the solid-phase during separation, reducing background signals (NSB; non-specific binding). The resulting firm, very visible pellet facilitates aspiration or decantation, resulting in improved precision and the enhanced sensitivity that this confers. Sac-Cel has been formulated to address the IgG fraction of the major host species for primary antiserum development, namely rabbit, sheep/goat, guinea pig, and mouse/rat. Sac-Cel has also been used for affinity purification, and a host of other laboratory applications not formally reported to us! Sac-Cel has also been incorporated into many commercial RIA products by clients in the USA, Germany and Scandinavia. We also use it in our own Vitamin D assays.
Info IDS LtdIDS Ltd
10 Didcot Way
Boldon Business Park
Boldon
Tyne & Wear
NE35 9PD
UK
Customer Service: 0191 519 6104
Fax Number: 0191 519 0760
Web Site: http://www.idsltd.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. MiniMACS Separation Unit from Miltenyi Biotec
2. MBS Magnetic Bead Separation - Te-MagS from Tecan
3. Cytosol/Particulate Separation Kit from BioVision
4. LIGHT DIAGNOSTICS™ CMV pp65 NH4Cl Leukocyte Separation Kit, alternate to #3246 from CHEMICON
5. LIGHT DIAGNOSTICS™ CMV pp65 Dextran Leukocyte Separation Kit, included in kit #3247 from CHEMICON
6. Cytosol / Particulate Rapid Separation Kit from MBL International
7. 6-Tube Magnetic Separation Rack from New England Biolabs
8. 12-Tube Magnetic Separation Rack from New England Biolabs
9. 50 ml Magnetic Separation Rack from New England Biolabs
10. R.A.P.I.D. System from Idaho Technology Inc.
11. CEQ 8800 Genetic Analysis System from Beckman Coulter
... proteins in polyacrylamide gel after SDS ... ng of protein) with *CoomassieR-G250. All ... can be performed in 1.5 hr. ... proteins can be seen before destaining. ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... a partial recombinant FES. ... 250 a.a) partial recombinant protein with GST ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: BC035357 ... AAH35357 OMIM: 190030, ...
Biology Products:
(Date:3/22/2017)... LIVERMORE, Calif. , March 21, 2017 ... recognition analytics company serving law enforcement agencies, announced today ... Sheridan as director of public safety business development. ... of diversified law enforcement experience, including a focus on ... Vigilant. In his most recent position, Mr. Sheridan served ...
(Date:3/13/2017)... , March 13, 2017 Future of security: Biometric ... ... DERMALOGs Face Matching enables to match face pictures ... the basis to identify individuals. (PRNewsFoto/Dermalog Identification Systems) ... DERMALOG,s "Face Matching" is the fastest software for biometric Face ...
(Date:3/7/2017)... 7, 2017   HireVue , the leading provider ... identify the best talent, faster, today announced the additions ... (CSO) and Diana Kucer as Chief Marketing ... executive team poised to drive continued growth in the ... year of record bookings in 2017. "Companies ...
Breaking Biology News(10 mins):
(Date:3/22/2017)... , March 22, 2017   Invitae ... growing genetic information companies, today announced the availability ... of Spinal Muscular Atrophy (SMA) , a ... lethal genetic disorders among infants as well as ... childhood. The new test, announced during the American ...
(Date:3/20/2017)... San Diego, CA (PRWEB) , ... ... ... chemicals (EDCs) are substances that interfere with the ability of endogenous hormones ... (agonists) or inhibiting ligand binding activity (antagonists), EDCs produce adverse reproductive, neurological, ...
(Date:3/20/2017)... Diego, CA (PRWEB) , ... March 20, 2017 ... ... novel therapies for gastrointestinal (GI) disorders, today announced that it has entered into ... (NRG-4) for therapies in inflammatory bowel disease including Necrotizing Enterocolitis (rare orphan disease) ...
(Date:3/20/2017)... ... March 20, 2017 , ... ... customizable plug & play system that counts Peel Plate microbial test colonies, stores ... This secure, stand-alone unit has an internal computer, and is accurate within 10% ...
Breaking Biology Technology: