Navigation Links
Amplifluor UniPrimer II Fluorescein from CHEMICON

ProductsAmplifluor UniPrimer II Fluorescein from CHEMICON
Company CHEMICON
Item Amplifluor UniPrimer II Fluorescein
Price $3,550.00
Description The Amplifluor UniPrimer-fluorescein is a hairpin primer labeled with a fluorescent energy transfer pair (fluorescein and non-fluorescent quencher) and a 3 single-stranded oligonucleotide tail. The UniPrimer is identical to the UniPrimer provided in the Amplifluor Universal Detection System (S7901) and is provided at a concentration of 5.0 M. Fluorescence (Linear:Hairpin): 39. Excitation = 495nm; Emission = 516nm.
Info CHEMICONCHEMICON
CHEMICON International, Inc.
28820 Single Oak Drive
Temecula, CA 92590
Customer Service: 800-437-7500
Tech Support: 800-437-7500
Fax Number: 800-437-7502
Web Site: http://www.chemicon.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. ABsolute QRT-PCR SYBR Green Fluorescein Mix from ABgene
2. Label IT siRNA Tracker Fluorescein Kit with TransIT-siQUEST Reagent from Mirus Bio Corporation
3. Label IT siRNA Tracker Fluorescein Intracellular Localization Kit with TransIT-TKO siRNA Transfection Reagent from Mirus Bio Corporation
4. CaspaTag™ Pan-Caspase In Situ Assay Kit, Fluorescein from CHEMICON
5. ApopTag Fluorescein Direct In Situ Apoptosis Detection Kit from CHEMICON
6. ApopTag Fluorescein In Situ Apoptosis Detection Kit from CHEMICON
7. In Situ Cell Death Detection Kit, Fluorescein from Roche Applied Science
8. Rat Anti-Mouse Endoglin Monoclonal Antibody, Fluorescein Conjugated, Clone 209701 from R&D Systems
9. Mouse Anti-Human DEP-1 / CD148 Monoclonal Antibody, Fluorescein Conjugated, Clone 143-41 from R&D Systems
10. Bovine Albumin from Bovine Serum, Fluorescein conjugated/tagged from Molecular Probes (Invitrogen)
11. Bovine BSA, Fluorescein conjugated/tagged from Biosearch Technologies
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: