Navigation Links
ATX Ponceau S red staining solution from Sigma-Aldrich

ProductsATX Ponceau S red staining solution from Sigma-Aldrich
Company Sigma-Aldrich
Item ATX Ponceau S red staining solution
Price 
Description Packaging: 6 bottles for 1 l ready-to-use-solution

  • ID clarifier: ready-to-use solution
Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Human / Mouse / Rat Blood Vessels (CD31 / Von Willebrand Factor (vWF)) IHC staining Kit from CHEMICON
2. Human Regulatory T cell (Foxp3 / CD4 / CD25) Flow Cytometry staining Kit from eBioscience
3. Murashige and Skoog basal salt solution with Gamborgs B5 vitamins, 10X concentrate from Research Organics, Inc.
4. IRsolution Software from Shimadzu
5. Tyrodes Salts solution from Sigma-Aldrich
6. Denhardts solution from Sigma-Aldrich
7. Denhardts powder mixture (for 50X stock solution) from AppliChem GmbH
8. LCMSsolution Software from Shimadzu
9. BlockAid blocking solution *for use with microspheres* from Molecular Probes (Invitrogen)
10. Escherichia coli alpha-Galactosidase Positionally specific solution from Sigma-Aldrich
11. LEUCOPERM Suspension fixation and permeabilization solution from GeneTex
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
...
Biology Products:
(Date:2/13/2020)... ... February 13, 2020 , ... ... with Nobio CEO Yoram Ashery to discuss how their revolutionary technology ... that combats bacteria to keep people healthy with their revolutionary nanoparticle technology. Nobio ...
(Date:2/10/2020)... ... 2020 , ... A Worcester Polytechnic Institute (WPI) bioinformatics researcher ... a major development that potentially holds the key to understanding the spread and ... the Wuhan coronavirus made available on the National Center for Biotechnology Information ...
(Date:2/5/2020)... ... February 04, 2020 , ... Crystal Diagnostics (CDx) ... a second patent related to proprietary liquid crystal technology for rapid and accurate ... the USPTO issued on December 3, 2019. Together, these patents protect the company’s ...
Breaking Biology News(10 mins):
(Date:2/19/2020)... ... February 18, 2020 , ... ... characterizing microbiome populations down to the strain level, recently unveiled a novel DNA ... for efficient and unbiased isolation of high molecular weight (HMW) single-stranded DNA (ssDNA) ...
(Date:2/19/2020)... ... February 19, 2020 , ... Red ... life sciences industry, today announced the opening of a new office in Tokyo, ... Nucleus R&D. , Red Nucleus announced the new office in response to customer ...
(Date:2/11/2020)... ... February 11, 2020 , ... ... announce the successful results from a long-term follow-up clinical study of outpatient ... fixation device (INSPAN LLC). Unlike extension block design, the Inspan device fixates ...
(Date:2/10/2020)... , ... February 10, 2020 , ... R3 Medical Training ... March 13-14th, 2020 in Las Vegas. The course is hands on involving real ... For the past few years, the Comprehensive Stem Cell Training Course has received rave ...
Breaking Biology Technology: