Navigation Links
6850 Networked GC from Agilent Technologies

Products6850 Networked GC from Agilent Technologies
Company Agilent Technologies
Item 6850 Networked GC
Price 
Description The Agilent 6850 Networked GC is an excellent choice for supporting hydrocarbon processing. In half the footprint of a standard dual-channel GC, this one-channel workhorse can double sample throughput by allowing two GCs in the space of one. You get all the capability and reliability you need for routine GC analyses in an instrument that has the same proven performance of Agilents flagship 6890 GC.
Info Agilent TechnologiesAgilent Technologies


US and Canada
395 Page Mill Rd.
P.O. Box #10395
Palo Alto, CA 94303
USA

For Agilent contacts in other countries
please click here.

Customer Service: 1-800-227-9770/1-302-993-5304
Web Site: http://www.agilent.com/chem
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Agilent ChemStation Plus Networked Data Systems from Agilent Technologies
2. S. pombe Whole Genome ChIP-on-chip from Agilent Technologies
3. S. cerevisiae yeast Whole Genome from Agilent Technologies
4. S. cerevisiae yeast Whole Genome from Agilent Technologies
5. Agilent 7500ce from Agilent Technologies
6. eArray from Agilent Technologies
7. Agilent Microarray hybridization Chamber Kits from Agilent Technologies
8. Multisignal Output Accessory from Agilent Technologies
9. One-Color RNA Spike-in Kit from Agilent Technologies
10. Two-Color RNA Spike-in Kit from Agilent Technologies
11. Multiple Affinity Removal System from Agilent Technologies
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products:
(Date:3/27/2017)... , March 27, 2017  Catholic Health Services ... Management Systems Society (HIMSS) Analytics for achieving Stage ... Model sm . In addition, CHS previously earned ... hospitals using an electronic medical record (EMR). ... high level of EMR usage in an outpatient ...
(Date:3/22/2017)... 2017   Neurotechnology , a provider of ... announced the release of the SentiVeillance 6.0 ... facial recognition using up to 10 surveillance, security ... The new version uses deep neural-network-based facial detection ... utilizes a Graphing Processing Unit (GPU) for enhanced ...
(Date:3/16/2017)... - Against identity fraud with DERMALOG solutions "Made in Germany "  ... ... multi-biometric solutions provide a crucial contribution against identity fraud. (PRNewsFoto/Dermalog Identification Systems) ... Used combined in one project, multi-biometric solutions provide a crucial contribution against identity ... ...
Breaking Biology News(10 mins):
(Date:5/23/2017)... ... May 23, 2017 , ... Cambridge Semantics , the leading provider of ... Bio-IT World Conference and Expo in Boston May 23-25 with a featured speaker ... Anzo Smart Data Lake is also a finalist for the Best of Show award. ...
(Date:5/22/2017)... PA (PRWEB) , ... May 22, 2017 , ... ... announced today that it is exhibiting in booth B2 at the Association for ... Pittsburgh, May 22-25. , In addition to demonstrating its Cancer Diagnostic Cockpit ...
(Date:5/19/2017)... (PRWEB) , ... May 19, 2017 , ... ... QED Proof-of-Concept Program. Academic researchers with technologies ripe for commercialization, and who ... Jersey and Delaware, are encouraged to submit proposals. QED, now in its tenth ...
(Date:5/18/2017)... ... ... NDA Partners Chairman Carl Peck, MD , announced today that Richard Kenley, ... Pharmaceutical Development Business Unit of Cardinal Health, has joined the firm as an Expert ... Chief Operating Officer at Anaborex, Senior VP and General Manager of the San Diego ...
Breaking Biology Technology: