Navigation Links
500-MS LC Ion Trap from Varian, Inc.

Products500-MS LC Ion Trap from Varian, Inc.
Company Varian, Inc.
Item 500-MS LC Ion Trap
Price Inquire
Description The Varian 500-MS LC Ion Trap is the instrument of choice for high-throughput LC/MS analysis where sensitivity, reliability and productivity are essential.

The Varian 500-MS provides a robust platform for demanding LC/MS/MS applications. The system sensitivity, mass resolution, and mass stability reflect the ion trap technologys inherent advantages, while the new enhanced charge capacity extends the number of ions that can be stored in the ion trap resulting in greater sensitivity and reduced background while delivering reliable qualitative and quantitative results.

By delivering excellent sensitivity over the entire mass range in full scan mode, and exceptional MS/MS and MSn capabilities, theVarian 500-MS quickly provides superior information for even the most complex sample matrices.

Sensitivity enhancements include SelecTemp, the unique temperature programmable API (Atmospheric Pressure Ionization), enabling optimal analysis of thermally labile compounds. All of these technical capabilities lead to the remarkable performance and productivity delivered by the Varian 500-MS LC ion trap.

Info Varian, Inc.Varian, Inc.
2700 Mitchell Drive
Walnut Creek, CA 94598

Call Varian, Inc. to buy products (US and Canada only; other locations use numbers below)
USA Canada 1-866-377-0104
Customer Service: 1-800-926-3000
Web Site: http://www.varianinc.com
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. Excalibur 3100 from Varian, Inc.
2. 1200 LC/MS from Varian, Inc.
3. Varian 820-MS from Varian, Inc.
4. Varian 2200 Ion Trap GC/MS from Varian, Inc.
5. Varian 810-MS from Varian, Inc.
6. Varian CP-4900 Micro-GC from Varian, Inc.
7. Cetac U-6000AT+ Ultrasonic Nebulizer with desolvation unit 220V, 50 Hz from Varian, Inc.
8. Cetac U-5000AT+, Ultrasonic Nebulizer 110V, 60 Hz from Varian, Inc.
9. Cetac U-6000AT+ Ultrasonic Nebulizer with desolvation unit 110V, 60Hz from Varian, Inc.
10. Varian NMR System from Varian, Inc.
11. Varian Cary 6000i Spectrophotometer from Varian, Inc.
... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...
Biology Products:
(Date:5/23/2017)...  Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...
(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...
(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...
Breaking Biology News(10 mins):
(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...
(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...
(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...
(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...
Breaking Biology Technology: