Navigation Links
4',6-Diamidino-2-phenylindole dihydrochloride (DAPI) from Sigma-Aldrich

Products4',6-Diamidino-2-phenylindole dihydrochloride (DAPI) from Sigma-Aldrich
Company Sigma-Aldrich
Item 4',6-Diamidino-2-phenylindole dihydrochloride (DAPI)
Price 
Description Cell permeable fluorescent minor groove-binding probe for DNA. Binds to the minor groove of double-stranded DNA (preferentially to AT rich DNA), forming a stable complex which fluoresces approximately 20 times greater than DAPI alone.

DAPI is several times more sensitive than ethidium bromide for staining DNA in agarose gels. It may be used for photofootprinting of DNA, to detect annealed probes in blotting applications by specifically visualizing the double-stranded complex, and to study the changes in DNA and analyze DNA content during apoptosis using flow cytometry. DAPI staining has also been shown to be a sensitive and specific detection method for mycoplasma.

Info Sigma-AldrichSigma-Aldrich
Sigma-Aldrich Corp.
St. Louis, MO, USA
Customer Service: 800-325-3010
Tech Support: 800-325-5832
Fax Number: 314-771-5757
Web Site: http://www.sigmaaldrich.com/
NOTE: Price information is approximate list price and actual prices may vary.

Related biology products :

1. 4,6-Diamidino-2-phenylindole, dihydrochloride (DAPI) from Pierce Biotechnology, Inc.
2. 4,6-diamidino-2-phenylindole, dihydrochloride (DAPI) from Molecular Probes (Invitrogen)
3. 4,6-diamidino-2-phenylindole, dihydrochloride (DAPI) *FluoroPure™ grade* from Molecular Probes (Invitrogen)
4. Glutathione-S-Transferase (GST) Colorimetric Assay Kit from Sigma-Aldrich
5. ATX Ponceau S red staining solution from Sigma-Aldrich
6. Corning Proculture Spinner Flask,15L,Vertical S/Arm, No. Of S/A 4,Cent Neck 100mm from Sigma-Aldrich
7. Bakers yeast (S. cerevisiae) Phosphoglucose isomerase from Sigma-Aldrich
8. Bakers yeast (S. cerevisiae) S-Acetyl-coenzyme A synthetase from Sigma-Aldrich
9. Enolase from bakers yeast (S. cerevisiae) from Sigma-Aldrich
10. S-Gal/LB Agar Blend from Sigma-Aldrich
11. Bakers yeast (S. cerevisiae) Hexokinase and glucose-6-phosphate dehydrogenase from Sigma-Aldrich
Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...
Agarose II (Low Melt)...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
Biology Products:
(Date:8/23/2017)... general public,s help is being enlisted in what,s thought to be the ... the human body –and are believed to affect health.  ... The Microbiome Immunity Project is the largest study to ... The project's goal is to help advance scientific knowledge of the role ... The ...
(Date:7/20/2017)... -- Delta (NYSE: DAL ) customers now can use fingerprints ... Washington National Airport (DCA). ... Delta launches biometrics to board aircraft at Reagan Washington National ... Delta,s biometric boarding pass experience that launched ... into the boarding process to allow eligible Delta SkyMiles Members who are ...
(Date:6/23/2017)... ARMONK, N.Y. and ITHACA, N.Y. ... IBM ) and Cornell University, a leader in dairy ... combined with bioinformatics designed to help reduce the chances ... breaches. With the onset of this dairy project, Cornell ... the Consortium for Sequencing the Food Supply Chain, a ...
Breaking Biology News(10 mins):
(Date:10/10/2017)... CA (PRWEB) , ... October ... ... a development-stage cancer-focused pharmaceutical company advancing targeted antibody-drug conjugate (ADC) therapeutics, today ... of targeted HPLN (Hybrid Polymerized Liposomal Nanoparticle), a technology developed in collaboration ...
(Date:10/10/2017)... ... , ... Dr. Bob Harman, founder and CEO of VetStem Biopharma, Inc. ... The event entitled “Stem Cells and Their Regenerative Powers,” was held on August ... MPVM was joined by two human doctors: Peter B. Hanson, M.D., Chief of Orthopedic ...
(Date:10/10/2017)... SANTA CRUZ, Calif. , Oct. 10, 2017 /PRNewswire/ ... SBIR grant from the NIH to develop RealSeq®-SC (Single ... preparation kit for profiling small RNAs (including microRNAs) from ... Cell Analysis Program highlights the need to accelerate development ... "New techniques for ...
(Date:10/10/2017)... ... October 10, 2017 , ... The Pittcon Program Committee is ... honoring scientists who have made outstanding contributions to analytical chemistry and applied spectroscopy. ... world’s leading conference and exposition for laboratory science, which will be held February ...
Breaking Biology Technology: