384 Round Well Plate Sterile with lid from Thermo Scientific

... Mouse monoclonal antibody raised ... Immunogen: ... 206 a.a) partial recombinant protein ... Accession Number: NM_005802 ...

Mouse monoclonal antibody raised against a full length recombinant SNAPC5. NCBI Entrez Gene ID = SNAPC5...

... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...

... Perm/Wash Buffer I can be used in ... to permeabilize cells and to serve as ... Because saponin-mediated cell permeabilization is a reversible ... cells in the presence of saponin during ...

Biology Products:

Mouse Anti-TOPORS Monoclonal Antibody, Unconjugated, Clone 4G4 from Abnova Corporation Mouse Anti-Human SNAPC5 Monoclonal Antibody, Unconjugated, Clone 6G10 from Abnova Corporation Mouse Anti-NFKBIB Monoclonal Antibody, Unconjugated, Clone 2B11 from Abnova Corporation BD Phosflow Perm/Wash Buffer I from BD Biosciences Pharmingen

(Date:5/23/2017)... Hunova, the first robotic gym for the rehabilitation and functional motor ... Genoa, Italy . The first 30 robots will be ... USA . The technology was developed and patented at the ... spin-off Movendo Technology thanks to a 10 million euro investment from entrepreneur ... ...

(Date:4/19/2017)... 2017 The global military biometrics ... marked by the presence of several large global players. ... five major players - 3M Cogent, NEC Corporation, M2SYS ... nearly 61% of the global military biometric market in ... global military biometrics market boast global presence, which has ...

(Date:4/11/2017)... April 11, 2017 Crossmatch®, a globally-recognized ... solutions, today announced that it has been awarded ... Projects Activity (IARPA) to develop next-generation Presentation Attack ... "Innovation has been a driving force within ... will allow us to innovate and develop new ...

Breaking Biology News(10 mins):

[3] Istituto Italiano di Tecnologia (IIT) and Movendo Technology Launch the Production of their First 30 Rehabilitative Hunova Robots [7] Military Biometrics Market: Demand for Advanced Technologies to Stop Illegal Immigration to Fuel Growth | TMR [2] Crossmatch Awarded $5.8 Million IARPA Contract to Develop Next-Gen Biometric Presentation Attack Detection Technologies

(Date:8/11/2017)... ... ... Algenist continues to disrupt the skincare industry with today’s debut of GENIUS Liquid ... the key structural element skin needs to maintain its youthful appearance and Algenist is ... First to market with proprietary collagen water active , Active ...

(Date:8/10/2017)... ... August 09, 2017 , ... Teachers from three Philadelphia middle ... 14th through the 16th, the University City Science Center will kick off the ... provides Philadelphia-based middle school educators an opportunity for professional development related to STEM ...

(Date:8/10/2017)... ... August 09, 2017 , ... Okyanos Center for Regenerative Medicine has announced its ... Hotel in Freeport, Grand Bahama on September 27, 2017. This daytime event is free ... from the Ministry of Health’s National Stem Cell Ethics Committee (NSCEC) and regulations laid ...

(Date:8/10/2017)... USA, and CARDIFF, UK (PRWEB) , ... August ... ... and photonics, has announced an agreement establishing Kinokuniya Company Ltd. as its exclusive ... SPIE as the exclusive sales representative for the SPIE Digital Library in Japan. ...

Breaking Biology Technology:

[0] Algenist Disrupts Skincare by Introducing First-Ever GENIUS Liquid Collagen™[0] Philadelphia Middle School Educators Integrate STEM Learning into the Classroom with University City Science Center’s FirstHand Teacher Institute [0] Okyanos Center for Regenerative Medicine to Hold Stem Cell Symposium in Freeport [0] Kinokuniya Company Ltd. named exclusive sales representative of SPIE Journals in Japan

Products	384 Round Well Plate Sterile with lid from Thermo Scientific
Company	Thermo Scientific
Item	384 Round Well Plate Sterile with lid
Price
Description	384 Round Well Plate Sterile with lid; Thermo Labsystems wide range of 384-well plates is ideal for high-throughput screening and research. These allow miniaturization of assays and are suitable for many applications including genomics and combinatorial chemistry.
Info	Thermo Scientific 450 Fortune Blvd. Milford, MA 01757 Customer Service: North America: 1-877-THERMO-U Fax Number: 508-520-2229 Web Site: http://www.thermo.com