Navigation Links
Women feel more pain than men, research shows

"This research is also consistent with studies that suggest that men and women experience chest pain in different ways and that, compared to men, women can sometimes report more intensive pain and nausea."

Another study has shown that interdisciplinary approaches to pain management may have different effects on women than men.

Working with the Royal National Hospital for Rheumatic Diseases in Bath, researchers from the Pain Management Unit carried out assessments on 98 patients in chronic pain as they went through a pain management programme involving physiotherapy, psychological treatments and occupational therapy.

Whilst both men and women exhibited a significant reduction in pain intensity both during and immediately after the programme, three months later women reported the same levels of pain as pre-treatment, whereas men's remained the same as immediately post-treatment. Interestingly, there were improvements in disability, in both sexes, which were maintained at follow-up. This suggested that there may also be important differences in pain experiences and improvements in disability.

"Gender can be profitably examined as a potential predictor of pain experience, and in particular, pain following treatment, but it is too early to say exactly how gender-specific interventions can be tailored to address these potentially important differences," said Dr Keogh.

"However, evidence is certainly converging to suggest that accounting for greater differences may increase the overall effectiveness of treatments."


'"/>

Source:University of Bath


Page: 1 2 3

Related biology news :

1. Men Estimate Mens Risks Of Common Disorders Higher Than Women Do, And Vice Versa
2. Women cautioned against using herbal supplements
3. Womans Day and For Womens of Science
4. Columbia research lifts major hurdle to gene therapy for cancer
5. U of M researcher examines newly emerging deadly disease
6. NYU researchers simulate molecular biological clock
7. First atlas of key brain genes could speed research on cancer, neurological diseases
8. New research questions basic tenet of neuron function
9. Vital step in cellular migration described by UCSD medical researchers
10. ASU researchers finds novel chemistry at work to provide parrots vibrant red colors
11. UCSD researchers maintain stem cells without contaminated animal feeder layers
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Women feel more pain than men research shows

(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
(Date:8/28/2014)... -- Next month, executives from clinical trial marketing firm BBK Worldwide ... Patient-Centered Clinical Trials 2014 , to be held at ... September 4-5. Patient recruitment experts Bonnie A. Brescia , ... share insights on the benefits of employing an effective patient ... media to mobile apps – can be used to drive ...
(Date:8/28/2014)... 28, 2014  Armetheon, Inc. ( www.armetheon.com ), ... to late-stage cardiovascular drug candidates, today announced that ... round of financing. The Series A round was ... with participation from investors that included Atheneos Capital ... Larry Hsu , the founder of Impax ...
(Date:8/28/2014)... Vt. (PRWEB) August 28, 2014 ... testing around the world is available from Strategic ... diagnostics companies. “ Industrial Microbiology Market Review, Fourth ... Industrial Market ” (IMMR—4) tracks and compares microbiology ... in North America, Europe and Asia, and forecasts ...
(Date:8/28/2014)... San Diego, CA (PRWEB) August 28, 2014 ... products, Pipette.com is offering a promotion for ... enables Pipette.com customers to purchase the highest quality ... Centrifuge Tubes are ideal for customers doing chemical, ... benefit lab technicians who are not regularly able ...
Breaking Biology Technology:BBK Worldwide Leads Sessions at Key September Events 2Armetheon Completes $7.0 Million Series A Financing 2Armetheon Completes $7.0 Million Series A Financing 32 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 22 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 3Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 2Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 3
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: