Navigation Links
UN pours polio vaccine into Yemen amid outbreak

As Yemen geared up for an end-of-month nationwide campaign to immunize all children under 5 against a fast-moving paralytic poliovirus outbreak, the United Nations Children's Fund (UNICEF) said it was shipping in 6 million doses of polio vaccine.

In addition, 10 experts from the World Health Organization (WHO) are working with national coordinators and helping to train vaccinators and supervisors, it said.

Yemen reported 41 confirmed cases today, up from 22 late last month, UNICEF said.

"Experience shows that sporadic polio outbreaks in previously polio-free countries, such as Yemen and Indonesia, can be stopped quickly, provided high-quality immunization campaigns are implemented rapidly. While these events strain the financial resources of the global eradication effort, they do not threaten its ultimate success," UNICEF said.

The Global Polio Eradication Initiative, formed by WHO, UNICEF, Rotary International and the US Centers for Disease Control and Prevention, needed $50 million by July and $200 million for 2006, it added.

UNICEF said polio has been losing its grip even on the exporting "reservoirs of transmission" -- northern Nigeria, northern India and Pakistan, with India reporting only 14 cases so far this year, all of them polio Type 1, and Pakistan six cases, while Nigeria had found no cases across its widely immunized southern states.

Through eradication efforts, the annual number of polio cases has dropped from 350,000 in 1988 to 1,267 cases in 2004, it said.

Six countries are polio-endemic ?Niger, Nigeria, India, Pakistan, Afghanistan and Egypt, it said, with another six where polio has been re-established ?Burkina Faso, the Central African Republic, Chad, Côte d'Ivoire, Mali and Sudan.


'"/>

Source:United Nations


Page: 1

Related biology news :

1. Survivors of childhood polio do well decades later as they age
2. Billions of dollars saved in US by polio vaccination
3. Research advances quest for HIV-1 vaccine
4. A much-needed shot in the arm for HIV vaccine development
5. Discovery of key proteins shape could lead to improved bacterial pneumonia vaccine
6. Gene vaccine for Alzheimers disease shows promising results
7. Influenza vaccine uses insect cells to speed development
8. Norovirus, AIDS vaccine and Hepatitis Virus
9. HIV vaccine trial breaks ground for future research
10. Live vaccines more effective against horse herpes virus
11. NIAID begins clinical trial of West Nile virus vaccine
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: pours polio vaccine into Yemen amid outbreak

(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: