Navigation Links
To slow AIDS in Russia, treat HIV-positive addicts, Stanford study says

The key to combating AIDS in Russia may be to treat HIV-infected drug users. A new model estimating the spread of HIV in Russia suggests that treating injection drug users with antiretroviral medication will slow transmission of the virus among the general population.

The study, which will appear in the December issue of the journal AIDS, was led by Douglas Owens, MD, a researcher at the Veterans Affairs Palo Alto Health Care System and professor of medicine at the Stanford University School of Medicine, and Margaret Brandeau, PhD, professor of engineering at Stanford.

Estimates vary, but around 1 million Russians - slightly more than 1 percent of the adult population - are infected with HIV, the virus that causes AIDS. Injection drug users account for three-quarters of all HIV cases in Russia, and the epidemic is spreading rapidly to non-drug users. According to the United Nations, Russia's HIV infection rate is among the fastest-growing in the world. By 2020, HIV could afflict 14.5 million Russians, according to a study from the Woodrow Wilson Center in Washington, D.C.

Advances in antiretroviral therapies have the potential to stem the spread of the virus in Russia, but in 2005 less than 1 percent of HIV-infected Russians - 5,000 people - received the life-extending drugs.

The situation is worse among drug users. "Almost no injection drug users in Russia are getting antiretroviral drug therapy," said Owens.

Antiretroviral therapies now combine multiple individual drugs to reduce the amount of virus in a person's body. The cumulative effect of two or three medicines works better than a single one to keep the virus at bay. Antiretroviral therapies have the added benefit of reducing the chances that an infected person will transmit HIV to others.

To understand how antiretroviral therapy could affect HIV transmission in Russia, Owens and Brandeau, along with doctoral student Elisa Long, creat
'"/>

Source:Stanford University Medical Center


Page: 1 2 3

Related biology news :

1. Protein discovery could unlock the secret to better TB treatment
2. Topical treatment shown to inhibit HIV and herpes simplex virus infection
3. Antarctic ice shelf retreats happened before
4. Weizmann Institute scientists develop a new approach for directing treatment to metastasized prostate cancer in the bones.
5. Researchers add new tool to tumor-treatment arsenal
6. Potential treatments for neurofibromatosis
7. Nanoparticles offer new hope for detection and treatment
8. Technique may allow cancer patients to freeze eggs, preserving fertility before starting treatment
9. PET/CT can identify new cancer lesions at early stage, allowing for prompt treatment
10. New understanding of DNA repair may pave way to cancer treatments
11. Multiple-drug resistant gene expression pattern predicts treatment outcome for pediatric leukemia
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: slow AIDS Russia treat HIV positive addicts Stanford study says

(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 20, 2013 New programme ... solutions for pharmaceutical and chemical sectors ... Pte. Ltd. and Siemens Pte. Ltd, have signed ... R&D Consortium Programme - Innovative Processing of Specialties ... Chemical and Engineering Sciences (ICES), the consortium offers ...
(Date:6/19/2013)... 2013 For an eco-friendly selection for ... Baths using metallic beads instead of water. The ... not require germicides. Yet, the bead bath delivers exceptional ... is always ready unlike a water bath, no warm-up ... bath, which eliminates the contamination and maintenance issues related ...
(Date:6/19/2013)... Bellevue, WA (PRWEB) June 19, 2013 ... open an exhibit hall of technology solutions for ... 6:30pm at the Hyatt Regency Bellevue. , ... to the public on Saturday and Sunday, will ... which includes power wheelchairs, communication devices, eyegaze technologies, ...
(Date:6/19/2013)... Miami, FL (PRWEB) June 19, 2013 An ... shed light on the increasing number of uses for probiotics. ... have probiotic qualities, and the associate benefits may beeb listed, ... health, reducing inflammation, and helping clear skin conditions. While the ... News shed light on the the uses of these “miracle” ...
Breaking Biology Technology:Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 2Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 3Pfizer, GSK, and Siemens Form R&D Consortium With A*STAR's Institute of Chemical & Engineering Sciences 4Cole-Parmer Introduces Eco-Friendly Waterless Bead Baths 2City of Bellevue, Wash., Welcomes Assistive Technology Exhibit Hall 2Natural Acne Remedy, Probiotic Action Explains the Science behind Using Probiotics for Better Health 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: