Navigation Links
Survival of heart patients on beta-blockers varies greatly with genetic variation

Survival of heart attack and unstable angina patients placed on beta-blocker therapy corresponds to specific variations in their genes, according to a study by researchers at Washington University School of Medicine in St. Louis and the Mid America Heart Institute in Kansas City. The study appears in the September 28, 2005 issue of the Journal of the American Medical Association.

"In our investigation of acute coronary syndrome (ACS) patients discharged on beta-blocker therapy, we were able to associate risk of death with the characteristics of the patients' beta-adrenergic receptor genes," says co-author Howard L. McLeod, Pharm.D., professor of medicine, of genetics and of molecular biology and pharmacology at the School of Medicine. "We identified high-, intermediate- and low-risk groups that had particular variations in these genes, which interact with beta-blocker drugs."

Patients in the high-risk group had a five times higher risk of death than those in the low-risk group according to the hazard ratio, a statistical measure of risk. If further research indicates that beta-blockers are ineffective or create a higher risk in patients with certain variations of beta-adrenergic receptor genes, physicians may modify treatment to improve survival in these patients, according to McLeod.

"These data, while provocative, should not immediately alter current practice," says lead author David E. Lanfear, M.D., formerly of the School of Medicine and now a member of the cardiology staff in the heart failure and cardiac transplant section at Henry Ford Hospital in Detroit. "Further investigation is needed to determine whether the effect seen is due to the lack of efficacy of beta-blockers in higher-risk patients or if genotype alone is responsible for a worse outcome."

Beta-adrenergic receptors in the sympathetic nervous system respond to adrenaline, but beta-blocker drugs block this interaction, slowing the heartbeat and lowering blood pressure
'"/>

Source:Washington University School of Medicine


Page: 1 2 3 4

Related biology news :

1. Adding Radiation Therapy To Chemotherapy Improves Survival In Patients With High-risk Breast Cancer
2. Protein That Promotes Survival Of Stem Cells Might Be Key To Poor Leukemia Prognosis
3. Bevacizumab Combined With Chemotherapy Improves Progression-Free Survival for Patients With Advanced Breast Cancer
4. Survival of the selfless - scientists find cheats dont always prosper
5. Survival of the rarest: Fruit flies shed light on the evolution of behavior
6. UCSD team discovers specialized, rare heart stem cells in newborns
7. Single stem cells from bone heal a broken heart
8. Python a hearty eater
9. Columbia study shows widely used artery clearing device does not help patients during heart attack
10. Researchers reveal secret of key protein in brain and heart function
11. Stem cell therapy successfully treats heart attack in animals
Post Your Comments:
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: