Navigation Links
Successful transplantation from pig embryos to mice

Millions of diabetics face a lifetime of daily injections to replace the insulin their bodies fail to produce, as well as a host of risks that includes blindness, amputation, kidney failure, and heart disease. For many, particularly those afflicted with juvenile diabetes, transplants of the pancreatic tissue in which insulin is produced might alleviate these problems. Unfortunately, there are not nearly enough organ donors available for transplantation.

Insulin-producing pancreas tissues from animals could potentially provide a nearly unlimited supply for transplantation. But until now, attempts to transplant such animal tissues into non-human primates have evoked a fierce immune response. However, embryonic tissues, such as those from pigs (in which the insulin-producing cells are similar to those of humans), might not be rejected as strongly. New research by Prof. Yair Reisner of the Weizmann Institute's Immunology Department has brought the possibility of transplants from pig embryos one step closer. The results of the study appeared in the June issue of PLoS Medicine.

In previous work, Reisner and his team had shown that each embryonic organ has its own 'time window' during which the chances for successful transplantation are optimal. Prior to this window, the early tissue's cells, which are still largely undifferentiated, can give rise to tumors. Past the window, however, they may be too well-developed: The host identifies these cells as foreign, causing the body to reject them. By transplanting tissues from pig embryos into mice lacking proper immune systems, they determined that the best time frame for pancreatic tissue was about a third of the way through gestation (from 42 to 56 days).

In the new study, Reisner's team wanted to see if such tissues could function in the body. They first implanted embryonic pancreatic tissue from pigs into mice that lacked an immune system of their own, but had human immune cells injected into them. Fr
'"/>

Source:American Committee for the Weizmann Institute of Science


Page: 1 2

Related biology news :

1. Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics
2. Visceral Leishmaniasis: Successful Vaccine Trial In Dogs
3. Penn Surgeons Use Completely Robotic Surgery to Successfully Treat Prostate Cancer
4. Successful cell engineering may lead to mad cow prevention, say researchers
5. Successful lung cancer surgery not enough to break nicotine dependence in many smokers
6. Monkeying around to improve organ transplantation
7. New cell transplantation technique restores insulin production in diabetics
8. Diabetes researchers pioneer islet cell xenotransplantation in primate studies
9. Guiding principles for facial transplantation unveiled
10. Plastic surgeons countdown first full facial transplantation
11. Researchers create genetically matched embryonic stem cells for transplantation
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Successful transplantation from pig embryos mice

(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: