Navigation Links
Stem cell treatment improves mobility after spinal cord injury

insulation for nerve fibers that is critical for maintenance of electrical conduction in the central nervous system. When myelin is stripped away through disease or injury, sensory and motor deficiencies result and, in some cases, paralysis can occur.

The researchers injected these cells into rats that had experienced a partial injury to the spinal cord that impairs walking ability -- one group seven days after injury and another 10 months after injury. In both groups, the early-stage cells formed into full-grown oligodendrocyte cells and migrated to appropriate neuronal sites within the spinal cord.

In the rats treated seven days after the injury, myelin tissue formed as the oligodendrocyte cells wrapped around damaged neurons in the spinal cord. Within two months, these rats began to show significant improvements in walking ability in comparison to injured rats who received no treatment.

In the rats with 10-month-old injuries, though, motor skills did not return. Although the oligodendrocyte cells survived in the chronic injury sites, they could not form myelin because the space surrounding neuron cells had been filled with scar tissue. In the presence of a scar, myelin could not grow.

These studies indicate the importance of myelin loss in spinal cord injury, and illustrate one approach to treating myelin loss. Keirstead and his colleagues are currently working on other approaches using human embryonic stem cells to treat chronic injuries and other disorders of the central nervous system.

In previous studies, Keirstead and colleagues identified how the body's immune system attacks and destroys myelin during spinal cord injury or disease states. They also have shown that when treated with antibodies to block immune system response, myelin is capable of regenerating, which ultimately restores sensory and motor activity.

Oswald Steward, Gabriel I. Nistor, Giovanna Bernal, Minodora Totiu, Frank Cloutier and Kelly Sharp
'"/>

Source:University of California - Irvine


Page: 1 2 3

Related biology news :

1. Protein discovery could unlock the secret to better TB treatment
2. Topical treatment shown to inhibit HIV and herpes simplex virus infection
3. Weizmann Institute scientists develop a new approach for directing treatment to metastasized prostate cancer in the bones.
4. Researchers add new tool to tumor-treatment arsenal
5. Potential treatments for neurofibromatosis
6. Nanoparticles offer new hope for detection and treatment
7. Technique may allow cancer patients to freeze eggs, preserving fertility before starting treatment
8. PET/CT can identify new cancer lesions at early stage, allowing for prompt treatment
9. New understanding of DNA repair may pave way to cancer treatments
10. Multiple-drug resistant gene expression pattern predicts treatment outcome for pediatric leukemia
11. Newer imaging techniques may lead to over-treatment
Post Your Comments:
(Date:12/3/2009)... undergo a personality change in warmer water, according to an ... species more aggressive. , Experiments with two species of young ... first time that some reef fish are either consistently timid, ... more marked as water temperatures rise. , A slight lift ...
(Date:12/3/2009)... included in the design of the upcoming forest deal at ... a scientist at the University of Leeds. , Writing ... at least 50% of the carbon credit payments to be ... and Degredation), should be made to forest dwellers directly, and ...
(Date:12/3/2009)... comes to investment in energy efficient technologies research, but ... Dave Delpy believes that more is needed: "Scientific and ... wind and solar power solutions, but more investment is ... we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Firm Says Low Cost Genome Sequencing Is Possible 60782 1Mom was right 3A Nice guys dont always finish last 60778 1Mom was right 3A Nice guys dont always finish last 60778 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 1DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 3
... CA--Version 2.4 of the Integrated Microbial Genomes (IMG) data ... for microbial genome data analysis, has now been released. ... Institute (DOE JGI), IMG has built a popular following ... offered in Spring 2008, now full. DOE JGI has ...
... various plants, animals and microorganisms, Systems Biology is regarded ... research. Current technologies allow biologists to spell all the ... little in the way of deciphering this complex code. ... give them new tools for use in drug discovery ...
... the new in vitro tests, called the Standard Scrapie ... accurate and extremely rapid way, producing results in less ... Panel Assay, allows researchers to quickly distinguish between several ... assays, the scientists were able to show that four ...
Other Biology News:World class in Systems Biology is the aim 2World class in Systems Biology is the aim 3World class in Systems Biology is the aim 4Scripps scientists develop new tests that identify lethal prion strains quickly and accurately 2
(Date:12/3/2009)... Dec. 3 VIA Pharmaceuticals, Inc. (Nasdaq: VIAP ... compounds for the treatment of cardiovascular and metabolic disease, ... visit in its Phase 2 FDG-PET clinical trial of ... and was carried out at five sites in the ...
(Date:12/3/2009)... 3 Inverness Medical Innovations, Inc. (NYSE: IMA ... of their health at home through the merger of rapid ... per share on its Series B Convertible Perpetual Preferred Stock ... Series B stock in an amount per share equal to ...
(Date:12/2/2009)... COLUMBIA, Md., Dec. 2 Martek Biosciences Corporation (Nasdaq: ... results of its fourth quarter and fiscal year 2009 on ... Following the release, at 4:45 p.m. ET Martek will ... All interested parties may listen to the call live ...
(Date:12/2/2009)... Reportlinker.com announces that a new market research ... Carbondioxide Incubators - A Global Market ... ,, Incubators are the most critical equipment ... other applications for providing a controlled environment ...
Breaking Biology Technology:VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 2VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 3VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 4Martek to Announce Fourth Quarter and Fiscal Year 2009 Results 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 3Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 4
... Net Results Improve for Year on Higher Services ... Digirad Corporation,(Nasdaq: DRAD ), a leading ... physicians, offices, hospitals and imaging centers, today,reported narrower ... 2007, on,higher annual revenues and lower operating expenses ...
... DIEGO, Feb. 7 ADVENTRX Pharmaceuticals,Inc. (Amex: ... pharmacokinetic data from,the Company,s marketing-enabling bioequivalence clinical ... for presentation at the 2008,American Association for ... April 12 - 16, 2008 in San ...
... Neal Skipper and Franco Cacialli, of the London ... Physics & Astronomy, University College London (UCL), have ... help them develop alternative fuel supplies for transport ... grant, with funding from the Wolfson Foundation under ...
Other Biology Technology:Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 2Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 3Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 4Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 5Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 6Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 7ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 2ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 3New funding to charge energy research at UCL and the London Centre for Nanotechnology 2
... & SSM4, Small space saving design - ideal ... of two models: , - 3D gyratory action ... , Digital speed control and built-in timer , Optional ... rockers are ideal where gentle mixing is required, either ...
...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Biology Products: