Navigation Links
No small feat: First ever gene therapy success for muscular dystrophy achieved

Researchers from the University of Pittsburgh report the first study to achieve success with gene therapy for the treatment of congenital muscular dystrophy (CMD) in mice, demonstrating that the formidable scientific challenges that have cast doubt on gene therapy ever being feasible for children with muscular dystrophy can be overcome. Moreover, their results, published in this week's online edition of the Proceedings of the National Academy of Sciences (PNAS), indicate that a single treatment can have expansive reach to muscles throughout the body and significantly increase survival.

CMD is a group of some 20 inherited muscular dystrophies characterized by progressive and severe muscle wasting and weakness first noticed soon after birth. No effective treatments exist and children usually die quite young.

Despite gene therapy being among the most vigorously studied approaches for muscular dystrophy, it has been beset with uniquely difficult hurdles. The genes to replace those that are defective in CMD are larger than most, so it has not been possible to apply the same methods successfully used for delivering other types of genes. And because CMD affects all muscles, an organ that accounts for 40 percent of body weight, gene therapy can only have real therapeutic benefit if it is able to reverse genetic defects in every cell of the body's 600 muscle groups.

By using a miniature gene, similar in function to the one defective in CMD, and applying a newly developed method for "systemic" gene delivery, the Pitt researchers have shown that gene therapy for muscular dystrophy is both feasible and effective in a mouse model of especially profound disease. Using this approach, the team, led by Xiao Xiao, Ph.D., associate professor of orthopaedic surgery and molecular genetics and biochemistry at the University of Pittsburgh School of Medicine, report that treated mice had physiological improvements in the muscles of the heart, diaphragm, abdomen and l
'"/>

Source:University of Pittsburgh Medical Center


Page: 1 2 3

Related biology news :

1. Stopping smallpox in its tracks: A new anti-viral approach
2. New World founders small in number
3. Secret of smallpoxs success may lead to bioterror cure
4. Circulating stem cells play small role in lung repair
5. LIAI scientists make major finding on potential smallpox treatment
6. Researchers develop new testing methods for potential monkeypox or smallpox outbreak
7. Solexa and collaborating scientists illuminate the small RNA component of the transcriptome
8. Delaware scientists make significant advance in study of small RNAs
9. Scientists learn to predict protein-stabilizing ability of small molecules
10. One small step means giant leap for spinal cord research
11. New study of the worlds smallest elephant
Post Your Comments:
(Date:3/20/2015)... 20, 2015 Research and Markets ... the "India Sensors Market Forecast and Opportunities ... The sensor market is projected to grow at ... Consumer electronics, automotive, industrial and healthcare sectors are ... country. In addition, adoption of MEMS technology in ...
(Date:3/19/2015)... Inc. (NASDAQ: NXTD ) ("NXT-ID" or the "Company"), ... market, announces its biometric payment technology, the Wocket® smart wallet ... on Washington DC,s Fox 5 News ... Next Great Thing", host Laura Evans calls the ... really big breakthrough in mobile payment.,  Award-winning ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... herbs, especially Mexican oregano, all contain apigenin and luteolin, ... lab by inhibiting an important enzyme, according to two ... cell death in two aggressive human pancreatic cancer cell ... pre-treated cancer cells with apigenin for 24 hours, then ...
... In a study published on line this week in ... Garland, Rosario Fernandez-Godino, and Eric Pierce of the Ocular ... Medical School, along with their colleagues, reported the unexpected ... inherited form of macular degeneration, turning off the animals, ...
... published papers, Tufts University School of Engineering researchers have ... cholera epidemics months before they occur and with a ... remote satellite imaging. Taken together, findings from these ... strengthen intervention efforts before the outbreak of cholera in ...
Cached Biology News:Celery, artichokes contain flavonoids that kill human pancreatic cancer cells 2Researchers report a critical role for the complement system in early macular degeneration 2Researchers report a critical role for the complement system in early macular degeneration 3Tufts scientists develop new early warning system for cholera epidemics 2Tufts scientists develop new early warning system for cholera epidemics 3
(Date:3/25/2015)... March 25, 2015  The Technology Association of ... dedicated to the promotion and economic advancement of ... Health as one of its Top 40 Innovative Technology ... recognize this prestigious group at the 2015 Georgia Technology ... Galleria Centre. TAG,S Top 40 Awards recognize ...
(Date:3/25/2015)... 2015  18 piglets born recently are the ... scientists in the College of Agriculture and Natural Resources at ... in the field of genetic engineering. Bhanu Telugu, ... & Avian Sciences (ANSC) and Ki-Eun Park, PhD, ... genome-edited pigs using a recently developed, groundbreaking technique ...
(Date:3/25/2015)... Proove Biosciences , a commercial ... announce the success of their commercially supported symposium, ... Optimize the Management of Pain, at the 31st Annual ... Maryland on Thursday, March 19th, 2015. , ... Lynn Webster , M.D., former Florida Society of ...
(Date:3/25/2015)... March 25, 2015   Demy-Colton Life Science Advisors ... and business development conferences exclusively for the biopharmaceutical and ... the Biotech CEO Summit. The Biotech ... brings together biotech industry leaders who are united by ... while reaping the rewards of biotech,s new golden age. ...
Breaking Biology Technology:Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 2Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 3Streamline Health, Inc. Named a TAG Top 40 Innovative Technology Company 4University of Maryland Researchers Successfully Produce Genome-edited Pigs Using Revolutionary Technology 2Proove Biosciences Hosts Symposium on Incorporating Genetic Testing to Optimize the Management of Pain 2Biotech CEO Summit to Bring Key Biotech Leaders Together in Industry Brain Trust 2
... Corporation,(OTC Bulletin Board: CONX), a worldwide developer and ... call on Thursday, September,25, 2008, at 4:00 PM ... for its fiscal year ended June 30, 2008, ... marketing activities., Corgenix invites all those interested ...
... ANNAPOLIS, Md., Sept. 15 PharmAthene, Inc.,(Amex: ... in the development and,commercialization of medical countermeasures ... it has received notification from,the Department of ... Company,s,proposal for its recombinant protective antigen anthrax ...
... Calif., Sept. 15 Advanced Chemical,Transport, one of ... the opening of a new location in Merced, ... environmental services -- hazardous,biological and radioactive waste disposal, ... environmental health and,safety outsourcing -- from the location ...
Cached Biology Technology:PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 2PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 3PharmAthene Response to DHHS Request for Proposals for Recombinant Protective Antigen Anthrax Vaccine Deemed Technically Acceptable and Within Competitive Range for Procurement Consideration 4Advanced Chemical Transport Opens Merced Facility 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... Buffer I can be used in intracellular ... permeabilize cells and to serve as an ... saponin-mediated cell permeabilization is a reversible process, ... in the presence of saponin during intracellular ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: