Navigation Links
Newly discovered virus linked to childhood lung disorders and Kawasaki disease

ory coronavirus infections are seasonal, peaking in the winter and spring; recent studies have described a powerful immune response in the respiratory tract and other organs in acute cases of Kawasaki disease, suggesting the involvement of a specific microbe, which may enter the body through the respiratory tract; finally, as the emergence of SARS illustrates, coronaviruses "are capable of enormously varied pathogenicity." Despite these encouraging preliminary observations, Dr. McIntosh noted that the association between this novel coronavirus and Kawasaki disease will require confirmation by others in larger future investigations.
'"/>

Source:Eurekalert


Page: 1 2 3

Related biology news :

1. Newly-discovered class of genes determines ?and restricts ?stem cell fate
2. Newly Discovered Compound Blocks Known Cancer-Causing Protein
3. Newly discovered pathway might help in design of cancer drugs
4. Newly Discovered Branding Process Helps Immune System Cells Pick Their Fights
5. Newly discovered protein an important tool for sleeping sickness research
6. Newly discovered genetic disease sheds light on bodys water balance
7. Newly Discovered Role for Heart Response Enzyme May Yield Better Heart Failure Therapy
8. Newly recognized gene mutation may reduce seeds, resurrect plants
9. Newly discovered birdlike dinosaur is oldest raptor ever found in South America
10. Fitting in: Newly evolved genes adopt a variety of strategies to remain in the gene pool
11. Newly identified mechanism helps explain why people of African descent are more vulnerable to TB
Post Your Comments:
(Date:6/18/2013)... D.C. June 18, 2013 Joshua Obar, Ph.D., ... has been honored with a 2013 ICAAC Young Investigator ... regulation of immunological memory responses to infection. , ... University in 2001 and went on to complete his ... 2006. He performed his Ph.D. thesis research in ...
(Date:6/18/2013)... Irvine, Calif., June 18, 2013 The herbal extract ... relief was found to increase the lifespan of fruit ... to UC Irvine researchers. , But it,s how ... root, did this that grabbed the attention of study ... Rhodiola works in a manner completely unrelated ...
(Date:6/18/2013)... to a chemical modification of DNA and this ... the DNA sequence. Until now, scientists believed that ... certain genes. Today, a team of researchers from ... Emmanouil Dermitzakis, Louis-Jeantet Professor at the Faculty of ... case and that DNA methylation may play both ...
Breaking Biology News(10 mins):The American Society for Microbiology honors Joshua Obar 2Herbal extract boosts fruit fly lifespan by nearly 25 percent, UCI study finds 2The secret of DNA methylation 2
... A newly discovered mechanism by which an infectious fungus ... virulence, according to Howard Hughes Medical Institute investigators at ... in light following fungal invasion of the human body ... sparks infection, the researchers said. , The discovery in ...
... irreversible damage to the heart that can cause ... the limited ability of the myocardium to regenerate ... University now document the existence of a previously ... with therapeutic potency for myocardial tissue regeneration following ...
... (WHO) warned about increased risk of vector-borne diseases ... areas in Southeast Asia. Nearly four weeks after ... the organization is strengthening its disease surveillance, stagnant ... multiply to sufficient levels, to potentially cause severe ...
Cached Biology News:Light therapy may combat fungal infections, new evidence suggests 2Light therapy may combat fungal infections, new evidence suggests 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 2WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 4
(Date:6/19/2013)... 19, 2013 Clinverse, Inc. ... for clinical trials, today announced it will be ... (booth #2000) in Boston, June 24-26, 2013. ... and only fully configurable, cloud-based clinical financial lifecycle ... module within Clinverse’s eClinical Commerce Network, automates site ...
(Date:6/19/2013)... 19, 2013 Bayer CropScience will honor ... Bee Care Community Leadership Award. The award will be ... Reception in Washington, D.C., an event where supporters of ... world’s food supply. , The Bayer Bee Care ... power of the honey bee colony to benefit their ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 India’s ... business can potentially be worth up to a ... opportunity, the Indian government is taking serious action ... the process. , This presentation will examine:, ... regulations ,     Immediate and long term impacts ...
(Date:6/18/2013)... June 18, 2013 Tabletop SEMs are ... SEMs but have limited performance and capability such as ... size SEMs would normally provide better imaging performance and ... operate and have a higher cost of maintenance. ... gap between these two types of SEM product, offering ...
Breaking Biology Technology:Clinverse, Inc. Exhibiting and Showcasing Its Technology at DIA 2013 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Nanounity Introduces the Pemtron Range of Compact Scanning Electron Microscopes 2Nanounity Introduces the Pemtron Range of Compact Scanning Electron Microscopes 3
... . -- Fiserv, Inc. said its Interactive Technologies ... A. Weber chief operating officer. In her new ... the Interactive Technologies Advantage Fee System software and ... clients. , ,Weber joins Interactive Technologies from ...
... biotechnology sector, she began to notice a certain pattern: Scientists ... the business world to be a much different place than ... , ,"Along the way, I realized that it was that ... a product just as effectively as a competitor," Villars said. ...
... J.J. Keller & Associates is launching Prospera ... tested on more than 13,000 human resources professionals, the ... built around five areas of concern for human resources ... on how those areas affect a company's bottom line; ...
Cached Biology Technology:Can tech people be business leaders? Upcoming seminar may have the answer 2Can tech people be business leaders? Upcoming seminar may have the answer 3J.J. Keller, Modine Manufacturing, Gustave A. Larson Co., Esker, Firstlogic, Software One 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: