Navigation Links
Mechanism regulating tooth shape formulation found

One of the remaining challenges for evolutionary developmental studies of mammals, whose evolution is best known from their teeth, is how their tooth shape is altered during development. Researchers of the University of Helsinki together with their Japanese colleagues from the University of Kioto now propose a 'balance of induction' mechanism directing the placement of tooth shape features called cusps. Position and shape of cusps determine whether a tooth shape belongs to human or mouse, for example. Whereas developmental initiation of cusp formation is known to involve several developmental genes at the places of future cusps, it has remained unknown how cusps form at the right places.

Computer simulations on tooth development have suggested that there should be a gene inhibiting induction of cusps. The research team has now identified this inhibitor to be a recently identified gene called ectodin. It turned out that ectodin is the first gene that is expressed as a mirror image of the future cusps.

The team generated a mouse that has no functional ectodin. Whereas the mice appear fairly normal, the areas forming cusps were much broader resulting in cheek teeth whose shape resembles more rhinoceros teeth than mouse teeth. Furthermore, these mice have extra teeth and sometimes adjacent teeth are fused. These results indicate that there is a delicate balance of induction and inhibition in determining tooth cusps and that ectodin is a key gene in this developmental control.

The team confirmed the importasnce of ectodin to development of teeth by culturing teeth that produce ectodin and teeth that lack ectodin with excess amounts of cusp inducing protein (bone morphogenetic protein or BMP). Whereas teeth producing ectodin develop quite normally with excess BMP, teeth without ectodin had a markedly accelerated induction of cusps. Indeed the researchers were able to induce cusps and mineralization of teeth much faster than happens in normal mouse
'"/>

Source:University of Helsinki


Page: 1 2

Related biology news :

1. Mechanism for the captation of nutrients in plants- unknown to date
2. Mechanism for Epstein-Barr virus proteins role in blood cancers discovered
3. Mechanism for memory revealed in neurons of electric fish
4. Mechanism identified for promising neurological drug
5. Mechanism for neurodenegerative diseases linked to transport proteins
6. Mechanisms involved with tumor relapse identified
7. Mechanism of nicotines learning effects explored
8. A new mechanism of regulating RNA degradation
9. Depression gene may weaken mood-regulating circuit
10. Proteins role in regulating cell death sets direction for cancer research
11. Scientists discover new regulating mechanism in cells
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Mechanism regulating tooth shape formulation found

(Date:6/18/2013)... D.C. June 18, 2013 Joshua Obar, Ph.D., ... has been honored with a 2013 ICAAC Young Investigator ... regulation of immunological memory responses to infection. , ... University in 2001 and went on to complete his ... 2006. He performed his Ph.D. thesis research in ...
(Date:6/18/2013)... Irvine, Calif., June 18, 2013 The herbal extract ... relief was found to increase the lifespan of fruit ... to UC Irvine researchers. , But it,s how ... root, did this that grabbed the attention of study ... Rhodiola works in a manner completely unrelated ...
(Date:6/18/2013)... to a chemical modification of DNA and this ... the DNA sequence. Until now, scientists believed that ... certain genes. Today, a team of researchers from ... Emmanouil Dermitzakis, Louis-Jeantet Professor at the Faculty of ... case and that DNA methylation may play both ...
Breaking Biology News(10 mins):The American Society for Microbiology honors Joshua Obar 2Herbal extract boosts fruit fly lifespan by nearly 25 percent, UCI study finds 2The secret of DNA methylation 2
... A newly discovered mechanism by which an infectious fungus ... virulence, according to Howard Hughes Medical Institute investigators at ... in light following fungal invasion of the human body ... sparks infection, the researchers said. , The discovery in ...
... irreversible damage to the heart that can cause ... the limited ability of the myocardium to regenerate ... University now document the existence of a previously ... with therapeutic potency for myocardial tissue regeneration following ...
... (WHO) warned about increased risk of vector-borne diseases ... areas in Southeast Asia. Nearly four weeks after ... the organization is strengthening its disease surveillance, stagnant ... multiply to sufficient levels, to potentially cause severe ...
Cached Biology News:Light therapy may combat fungal infections, new evidence suggests 2Light therapy may combat fungal infections, new evidence suggests 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 2WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 3WHO Warns Of Increased Risk Of Vector-borne Diseases In Tsunami-affected Areas 4
(Date:6/18/2013)... June 18, 2013 The human skin is ... as an important human body part. Similar to the liver, ... order to function, repair and grow. Recent reports from the ... supplements, is just as important as other life supporting organs. ... aid in skin cell reproduction, increase the appearance of skin, ...
(Date:6/18/2013)... , June 18, 2013 ... using the company,s  proprietary AMCA Guided Bone Regeneration (GBR) Dental ... implants. A common problem encountered when patients have ... of sufficient bone volume to house the implant. Consequently there ... bone substitute until the natural bone regenerates. The bone substitute ...
(Date:6/18/2013)... June 18, 2013 ... research firm, announces the initiation of full ... biopharmaceutical company developing and marketing products for ...      (Logo: http://photos.prnewswire.com/prnh/20130417/608168) ... examining the investment merits of BioAlliance Pharma, ...
(Date:6/18/2013)... , June 18, 2013 Mapi ... (APIs), generic and innovative intermediates, and finished dosage forms based ... has been granted a United States ... Europe for the oral treatment of ... is titled Intermediate Compounds and Processes for the Preparation ...
Breaking Biology Technology:Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 2RegeneCure Starts Clinical Study Using Polymeric Bone Stimulating Membrane for Dental Implants 3Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 2Edison Expands French Healthcare Sector Coverage With Initiation of Coverage on BioAlliance Pharma 3Mapi Pharma Granted United States Patent for Pain Relief Medication "Tapentadol" 2
... . -- Fiserv, Inc. said its Interactive Technologies ... A. Weber chief operating officer. In her new ... the Interactive Technologies Advantage Fee System software and ... clients. , ,Weber joins Interactive Technologies from ...
... biotechnology sector, she began to notice a certain pattern: Scientists ... the business world to be a much different place than ... , ,"Along the way, I realized that it was that ... a product just as effectively as a competitor," Villars said. ...
... J.J. Keller & Associates is launching Prospera ... tested on more than 13,000 human resources professionals, the ... built around five areas of concern for human resources ... on how those areas affect a company's bottom line; ...
Cached Biology Technology:Can tech people be business leaders? Upcoming seminar may have the answer 2Can tech people be business leaders? Upcoming seminar may have the answer 3J.J. Keller, Modine Manufacturing, Gustave A. Larson Co., Esker, Firstlogic, Software One 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: