Navigation Links
Map of life on Earth could be used on Mars

A geologist from Washington University in St. Louis is developing new techniques to render a more coherent story of how primitive life arose and diverged on Earth ?with implications for Mars. Carrine Blank Ph.D., Washington University assistant professor of earth and planetary sciences in Arts & Sciences, has some insight concerning terrestrial microbes that could lead to provocative conclusions about the nature of life on Mars and other planets.

Blank approaches the task by resolving phylogenetic trees. These trees, based upon genetic sequencing data, trace the genetic relationships between what we think of as primitive organisms through trait development. The relationships between early forms of life can illuminate the relationships between organisms present on Earth today ?which fossil evidence and a method called isotopic fractionation have failed to show conclusively.

Blank most recently presented her research at the 2004 annual meeting of the Geological Society of America. Microorganisms can be divided into haves and have-nots: cells of eukaryotes contain a nucleus, while prokaryotic organisms cells do not. Prokaryotic organisms encompass archeal and bacterial domains of life. Archeal organisms diverge further into euryarcheota and Crenarcheota lineages. By piecing together genetic sequences of the three types of prokaryotic organisms, Blank creates a genetic flow chart, which can be interpreted to trace the appearance of environmental adaptations across billions of years of evolution.

Genes are inherited from parents, but can transfer from one organism to another without reproducing by a process called lateral gene transfer. Modular metabolic genes, which are not critical for cell production, account for most lateral gene transfers between microbes.

"There is a lot we're beginning to understand in terms of bacterial evolution that is still not quite clear, " Blank said. "What we're trying to resolve is the evolutionary histo
'"/>

Source:Washington University in St. Louis


Page: 1 2 3

Related biology news :

1. UCSB scientists probe sea floor venting to gain understanding of early life on Earth
2. U.N. mulls the protection of Earths forests
3. ORNL, UC Berkeley unravel real-world clues to Earths mysteries
4. Study casts doubt on Snowball Earth theory
5. Evolution of life on Earth may hold key to finding life in outer space
6. Bacteria which sense the Earths magnetic field
7. New study pinpoints epicenters of Earths imminent extinctions
8. Understanding the oceans microbes is key to the Earths future
9. NASAs AURA satellite peers into Earths ozone hole
10. New maps reveal true extent of human footprint on Earth
11. Embryos tell story of Earths earliest animals
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Map life Earth could used Mars

(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: