Navigation Links
Deep sea buffet for bone-devouring worms

Press release based on a recently published article in Environmental MicrobiologyAn unusual relationship between bacteria and a newly discovered group of marine worms is the only known partnership (or symbiosis) which uses sunken marine mammals as its sole source of nutrition.

In the September issue of Environmental Microbiology, Dr Shana Goffredi and her colleagues reveal this unique partnership between bacteria and the Osedax (bone-devouring) group of marine worms.

Symbiosis, or the living together of different organisms, allows some species to live in otherwise hostile environments, so it can be a powerful mechanism of evolutionary change. This is especially true in the deep sea. Survival in some deep-sea environments requires capabilities that animals alone don't possess. So teaming up with a microbial partner is the secret of survival for many host animals living in such environments.

Dr Goffredi says: "Measures of significant population sizes, and the discovery of four additional host species in only three years, suggests that the Osedax worms and their bacterial 'partners' are likely to play substantial roles in the cycling of nutrients into the surrounding deep-sea community."

This can be put into context by considering that the Osedax worms and their symbiotic bacteria can turn-over a large amount of organic carbon (one whale carcass may weigh up to 50 tons), approximately 2000 years faster than the usual mechanism of carbon deposition to the deep seafloor.

The results of this study will aid understanding of the potential for adaptation between animals and microbes.


'"/>

Source:Blackwell Publishing Ltd.


Page: 1

Related biology news :

1. A buffet for early human relatives
2. The secret to longevity in tubeworms
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: Deep sea buffet for bone devouring worms

(Date:10/16/2014)... war on the human body. Battles are won, ... pancreatic cancer, this stalemate—known as tumor dormancy—can last ... a phenomena that is poorly understood. , ... of Salvatore Torquato, a Professor of Chemistry at ... tumor dormancy and the switch to a malignant ...
(Date:10/16/2014)... and Washington land managers have a new synthesis of ... moist mixed-conifer (MMC) forests in the two states. ... in Eastern Oregon and Washington: A Synthesis of the ... a general technical report published by the U.S. Forest ... to a request from managers for a synthesis of ...
(Date:10/16/2014)... be cultivated efficiently, they are anything but sustainable: ... monoculture cultivation is becoming increasingly evident. Despite their ... and are regarded as the sole possibility of ... wrongfully, finds Bernhard Schmid, an ecology professor at ... form of agriculture and forestry. After all, a ...
Breaking Biology News(10 mins):Modeling tumor dormancy 2New report synthesizes best available science on management of moist mixed-conifer forests 2Plant communities produce greater yield than monocultures 2Plant communities produce greater yield than monocultures 3
... by biophysicist Stuart Lindsay from the Biodesign Institute ... reproducible single molecule negative differential resistor ?and in ... that provides a “roadmap?for designing single-molecule devices based ... 18 by Lindsay at the American Association for ...
... distinctive tissues, such as heart, bone, and brain. At ... arose from various sets of genes switched on inside ... lack a protein that permanently turns off neuronal genes ... it turns out that precursor nerve cells contain that ...
... Affymetrix Inc. (Nasdaq: AFFX), announced today the launch ... protocol developed in conjunction with PreAnalytiX -- a ... Prime Standard: QIA) and BD (Becton, Dickinson and ... Blood RNA System for use with Affymetrix GeneChip ...
Cached Biology News:Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 2Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 3Gene keeps neural cells on correct developmental path 2Gene keeps neural cells on correct developmental path 3Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 2Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 3
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... Crosse, Wis. - Firstlogic, Inc ., a ... Crate and Barrel housewares retailer has deployed ... in its new customer management system initiative. , ,The ... quality in all aspects of its sales and communications ...
... calls to run government institutions as a business, with ... shareholders: taxpayers. Now schools are facing similar scrutiny. The ... Act have expanded the federal regulations with which schools ... also demanding more budget accountability at a time when ...
... Gov Jim Doyle on Thursday announced that three Wisconsin ... the Department of Commerce Technology Assistance Grant (TAG) and ... as follows: , , Functional Biosciences, Inc. ... provide DNA sequencing. It will receive a $250,000 TVF ...
Cached Biology Technology:Looking to software to manage the business of education 2Looking to software to manage the business of education 3Looking to software to manage the business of education 4
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: