Navigation Links
AIDS Public Awareness Campaign Expands Following Report Of Rapidly Progressive HIV

$450,000 on this important television advertising initiative.

The "Project Wave" awareness campaign focuses on the importance of knowing one's HIV status and getting tested. The campaign features television promotions with national celebrities, including Alicia Keys.

The initiatives announced today build on the public awareness efforts now underway in New York. The Department is currently running a prevention campaign called "HIV Stops with Me." This social marketing campaign uses community role models to promote the importance of people with HIV taking precautions to prevent transmitting the virus to others. This prevention campaign includes the use of bus and subway advertisements in New York City and Buffalo.

New York State has some of the strongest confidentiality protections in place for HIV in the nation. "No one should be afraid to get tested for HIV," Dr. Novello said. "Remember, this virus knows no racial, ethnic, age or gender boundaries. It is what you do, not who you are, that puts you at risk for HIV."

Individuals who wish to get tested may choose to do so anonymously or confidentially. With anonymous testing, a person does not provide his or her name, but instead receives an identifying number. Anonymous testing is available through many local health departments and community-based sites throughout the state. Confidential testing is also available in which patients provide their names to health care providers.

HIV testing is especially important for pregnant women, because medicine is available that can reduce the risk of maternal/child HIV transmission. Mothers who know they are HIV positive also will be advised against breast-feeding.

Under the Governor's leadership, New York has achieved a dramatic 78 percent decline in the number of newborns statewide who are infected with HIV. The results are derived from a recent State Health Department study of infants born between 1997 and 2002. In addition, New Y
'"/>

Source:New York State Department Of Health


Page: 1 2 3

Related biology news :

1. NIH Calls on Scientists to Speed Public Release of Research Publications
2. Public collections of DNA and RNA sequence reach 100 gigabases
3. Public release of pig genomic sequences
4. PLoS ONE is launched by the Public Library of Science
5. Public Library of Science to launch new, open access journal on neglected tropical diseases
6. Mailman School of Public Health researchers report blood DNA can be early predictor of liver cancer
7. Report that delayed motherhood decreases life expectancy of mouse offspring
8. Report focuses on challenges to unlocking future promise of vaccines
9. Report finds cruise industry is protecting the precious places it visits
10. Report shows deforestation threatens Brazils Pantanal
11. Report lists top 20 most-vulnerable African carnivores
Post Your Comments:
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
(Date:3/27/2015)... NEW YORK , March 27, 2015  Peter ... in Biomedical Science for his pioneering work on how ... the components of a regulatory mechanism that cells use ... proteins. Dr. Walter is a professor of biochemistry at ... the groundwork for treating a range of human diseases ...
(Date:3/27/2015)... March 27, 2015 WuXi PharmaTech (Cayman) ... R&D capability and technology platform company serving the ... today that an Investigational New Drug (IND) application ... rheumatoid arthritis has been accepted for review by ... In September 2012, MedImmune, the global ...
(Date:3/27/2015)... Buffalo, New York (PRWEB) March 27, 2015 ... of the 2015 application period for 43North - the ... cash prizes, including a grand prize of $1 million, ... attracts entrepreneurs from around the world to compete for ... into funded enterprises in the Western New York region. ...
(Date:3/26/2015)... San Bruno, CA (PRWEB) March 26, 2015 ... organization (CRO), announced today several management and executive ... role of Chief Financial Officer (CFO) and member of ... Vice President of Business Operations, and Sue Dowden will ... Tony Taricco, co-founder and current Chief Operations Officer (COO), ...
Breaking Biology Technology:German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 2German-born cell biologist Peter Walter wins the 2015 Vilcek Prize in Biomedical Science 3Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 2Investigational New Drug Application for WuXi MedImmune's Monoclonal Antibody Accepted for Review by CFDA 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 2Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 3Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 4Governor Andrew M. Cuomo Anounces Launch of Year Two of World's Largest Business Idea Competition and Opening of New Incubator Space in Buffalo, New York 5PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 2PRC Clinical Announces Key Management Appointments and Launches East Coast Operations 3
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: