Navigation Links
A frog's life is food for thought

of their gut biology and physiology," she said.

"We put animals into aestivation and woke them up and fed them to find out how quickly they got everything going again."

Ms Cramp's results show that animals can maintain the functional capacity of the gut during aestivation despite significant energetic cost, allowing them to digest food as soon as they resurface from aestivation.

"Despite the marked decrease in absorptive surface area of the gut of aestivating frogs, they appear to actually increase their absorptive capacity during aestivation," she said.

"Within 36 hours of the ingestion of the first meal the gut had all but returned to its pre-aestivation state, and by the completion of digestion of the first meal the gut was operating on par with that of non-aestivating frogs," she said.

"This rate of rectification of gut morphology is virtually unparalleled with the small intestine having increased in mass by 450 percent within just 36 hours."

The results of Ms Cramp's study could have important implications for human survival.

"Human survivors of starvation can endure the horrific and often fatal effects of re-feeding after starvation, including massive diarrhoea and gastric ulcers," she said.

"Science still understands very little about why that occurs and what can be done about it."

Ms Cramp said scientists originally thought that during aestivation frogs would shut down all non-essential energy consuming processes. Her results contradict this theory.

"It was really interesting to us that they do not appear to shut down the functional aspect of their gut biology," she said.

"It is important that they are able to eat and digest from the first meal because they are only up for as little as a week at a time before they have to go back down again."

The results of the study were featured in a recent edition of Science magazine and form the basis of Ms Cramp's PhD study,
'"/>

Source:Research Australia


Page: 1 2 3

Related biology news :

1. Different microarray systems more alike than previously thought
2. Atmosphere may cleanse itself better than previously thought
3. Lifes origins were easier than was thought
4. Alleged 40,000-year-old human footprints in Mexico much, much older than thought
5. Deep-rooted plants have much greater impact on climate than experts thought
6. Avian flu transmission to humans may be higher than thought
7. The diversity of marine life in the Gulf of Maine region is much greater than previously thought
8. Memory loss affects more of the brain than previously thought
9. Brain works more chaotically than previously thought
10. Liver regeneration may be simpler than previously thought
11. Anthrax attack posed greater potential threat than thought
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: frog life food for thought

(Date:5/7/2015)... Sweden , May 7, 2015 ... touch fingerprint sensors, FPC1022 and FPC1035, FPC,s smallest ... and FPC1035 are mainly considered for integration on ... size gives smartphone OEMs increased possibilities to integrate ... The decreased size also improves possibilities for module ...
(Date:5/5/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market, reminds investors and media that  Mr. ...  at CARTES SECURE CONNEXIONS AMERICA 2015, held in ... The three-day conference is organized into a series of nine ... Global Fraud: Where is the Trust in Cyberspace? ...
(Date:4/27/2015)... Apr. 27, 2015 NXT-ID, Inc. (NASDAQ: ... company focused on the growing mobile commerce market, announces ... pre-order customers the first week of May, 2015 and ... of May. Gino Pereira , ... for the company as Wocket® enters the consumer market. ...
Breaking Biology News(10 mins):FPC Introduces its Smallest Touch Fingerprint Sensors to Date 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 2NXT-ID, Inc.'s CTO, David Tunnell, Presents at CARTES SECURE CONNEXIONS AMERICA 2015 Today in Washington DC. 3Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 2Wocket, the Smartest Wallet You Will Ever Own, Announces Shipment to Pre-order Customers 3
... change on the microbial communities of two important ecosystemsthe ... a University of Oklahoma research group has been awarded ... to Jizhong Zhou, OU professor of botany and microbiology ... results of these studies could potentially contribute to the ...
... Medical Research in Melbourne, Australia, has entered a ... to evaluate and potentially develop for research and ... The institute has a portfolio of more than ... facility for research into cancer, chronic inflammatory diseases ...
... scientists from Singapore led by the Genome Institute of ... Biology (IMCB), two biomedical research institutes of Singapore,s ... the most important genes in human embryonic stem cells ... cells work. Their research, published in top scientific journal ...
Cached Biology News:Biotech collaboration established to commercialize research reagents 2Singapore scientists first to perform genome-wide study of human stem cells 2
(Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
(Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
(Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
(Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
... Created Role of Senior Vice President of ... Philip R. Licari to Step Down as Chief Operating Officer upon Closing ... ... ), the manufacturer of the NxStage System One (TM),portable kidney dialysis machine, today ...
... SAN CARLOS, Calif., Aug. 29 Nektar,Therapeutics (Nasdaq: ... Lingnau has been,appointed to serve on its board ... with over 35 years of experience in,corporate management, ... to Nektar extensive pharmaceutical development and,commercialization experience at ...
... Colo., Aug. 29 Pharmion Corporation,(Nasdaq: PHRM ... Drug Administration,(FDA) has granted Fast Track designation for ... Fast Track programs are designed to facilitate ... that are intended to treat serious or,life-threatening conditions ...
Cached Biology Technology:NxStage Medical Provides Update on Medisystems Acquisition 2NxStage Medical Provides Update on Medisystems Acquisition 3NxStage Medical Provides Update on Medisystems Acquisition 4NxStage Medical Provides Update on Medisystems Acquisition 5Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 2Nektar Therapeutics Appoints Lutz Lingnau as New Board Member 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 2Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 3Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 4Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 5Pharmion's Oral Azacitidine Granted Fast Track Status for Myelodysplastic Syndromes 6
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: