Navigation Links
U-M team recovers ancient whale in Egyptian desert

reating severe blood-loss injury, hypothermia, malignant fever, cardiac arrest and stroke.

The potential medical benefits also include improving cancer treatment by allowing patients to tolerate higher radiation doses without damaging healthy tissue. Cancer cells, Roth explained, aren't dependent on oxygen to grow. As a result, they are more resistant to radiation than surrounding healthy cells, which need oxygen to live. Roth hypothesizes that temporarily eliminating oxygen dependence in healthy cells could make them a less-vulnerable target for radiation and chemotherapy and thus spare normal tissue during high-dose cancer therapy.

"Right now in most forms of cancer treatment we're killing off the normal cells long before we're killing off the tumor cells. By inducing metabolic hibernation in healthy tissue we'd at least level the playing field," he said. The delivery of such treatment could be as simple as an intravenous infusion of saline solution mixed with trace amounts of an agent that would interfere with the body's ability to use oxygen, Roth said.

Using oxygen deprivation to depress metabolic activity also might extend the amount of time that organs and tissues could be preserved outside the body prior to transplantation, Roth said. Yet another potential application of oxygen deprivation would include accelerating wound healing in patients, such as diabetics, whose ability to do so is compromised. This could reduce the number of amputations caused by irreparable tissue damage from wounds that won't heal. A wound to the skin allows the entry of oxygen, which initiates cell death. In healthy people, cell death subsides when a clot forms, which allows the healing process to begin. Exposing a diabetic's clot-resistant wound to an oxygen-free environment would speed the healing process.

While the notion of putting a human or a human organ into an oxygen-free state of biological limbo and then reversing the process at will with no
'"/>

Source:


Page: 1 2 3 4 5

Related biology news :

1. Researchers find missing genes of ancient organism
2. Family trees of ancient bacteria reveal evolutionary moves
3. Scientists find fossil proof of Egypts ancient climate
4. Deep sea algae connect ancient climate, carbon dioxide and vegetation
5. Analysis of flower genes reveals the fate of an ancient gene duplication
6. World-first technology enables study of ancient bacteria
7. Did humans cause ecosystem collapse in ancient Australia?
8. MBL researchers probe how an ancient microbe thrives and evolves without sex
9. A salty tale: New bacterial genome sequenced from ancient salterns
10. UF scientists reveal ancient origin of vertebrate skeleton
11. UF scientists reveal ancient origin of vertebrate skeleton
Post Your Comments:
*Name:
*Comment:
*Email:
TAG: team recovers ancient whale Egyptian desert

(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... His Majesty Willem-Alexander, King of the Netherlands ... His Majesty Willem-Alexander, King of the Netherlands, has announced ... POET-DSM Advanced Biofuels’ Project LIBERTY cellulosic ethanol plant in ... will take part in the Grand Opening Ceremony to ... p.m. and tour the plant. POET-DSM is a joint ...
(Date:8/21/2014)... , Aug. 21, 2014  Decision Resources ... Brazil and Mexico ... uptake of several newly approved agents, the anticipated ... indication and the launch of emerging biologics will ... In particular, the emerging IL-5 inhibitors will introduce ...
(Date:8/21/2014)... -- China Cord Blood Corporation (NYSE: CO ) ... results for the first quarter of fiscal year 2015 ... the US.  The Company will host ... August 29, 2014 to discuss its financial performance and ... followed by a question and answer session.  Interested parties ...
(Date:8/21/2014)... 2014 Ontotext S4 , The ... Ontotext . Now the same enterprise hardened text ... and unstructured data is available to start-ups and mid-size ... technology. Organizations that do not have resources to evaluate ... use S4 since there is no need for on ...
Breaking Biology Technology:His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 2His Majesty Willem-Alexander, King of the Netherlands, to Attend Project LIBERTY opening 3Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 2Asthma Agents Currently Face a Suboptimal Coverage Environment in Brazil and Mexico, and as the Treatment Armamentarium Expands, Competitiveness Will Further Intensify 3China Cord Blood Corporation to Report First Quarter of Fiscal 2015 Financial Results 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 2Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 3Ontotext Releases Text Mining & Semantic Technology Running in the Cloud – Welcome to “S4? 4
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: