Navigation Links
Your finger's pulse holds the key to your heart's health
Date:9/4/2013

ttack.

Since people can live for years without any knowledge of existing cardiovascular problems, this new measurement tool is especially important. It can provide useful diagnostic information for middle-aged and older patients, who are most susceptible to having hardened arteries that can lead to heart disease.

Regular assessments of the aorta may help reduce those risks. Pierce's instrument measures notes the speed, called aortic pulse wave velocity, at which the pulse moves between two points. The UI team validated the new instrument's performance against the carotid-femoral-artery pulse wave velocity tests, considered the gold standard for determining aortic stiffness.

"Finding simple noninvasive methods to measure aortic pulse wave velocity in the clinic may help physicians to better inform middle-aged and older adults about their level of cardiovascular risk," Pierce says, noting that past studies have shown that regular exercise protects the aorta from hardening in those age groups.


'/>"/>

Contact: Richard Lewis
richard-c-lewis@uiowa.edu
319-384-0012
University of Iowa
Source:Eurekalert

Page: 1 2

Related biology news :

1. New frog species from Panama dyes fingers yellow
2. What mechanism generates our fingers and toes?
3. Taking the pulse of volcanoes using satellite images
4. CellTrust SecureSMS PULSE Integrated to Santech Health for Secure Text Messaging of Biometrics and PHI will be Demonstrated at HIMSS 2013
5. Feinstein Institute collaborates with GSK, UPenn, MIT to research bodys electrical impulses
6. UofL research holds promise of therapeutic approach for gum disease
7. When the soil holds not enough phosphorus
8. Remote Siberian lake holds clues to Arctic -- and Antarctic -- climate change
9. New compound holds promise for treating Duchenne MD, other inherited diseases
10. B cell survival holds key to chronic graft vs. host disease
11. Vitamin D holds promise in battling a deadly breast cancer, Saint Louis University researchers say
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... Fruit and vegetable consumption could be as good for ... , The research, conducted by the University of Warwick,s ... England, and published by BMJ Open focused ... mental wellbeing were consistently associated with an individual,s fruit ... mental wellbeing ate five or more portions of fruit ...
(Date:9/23/2014)... infant chimpanzees from their mothers are well documented, little ... of early life experience. In a year-long study, scientists ... that those who were removed from their mothers early ... performers are likely to show behavioral and social deficiencies ... in the open-access journal PeerJ , was led ...
(Date:9/22/2014)... GAINESVILLE, Fla. --- Many native species have vanished ... University of Florida scientists have discovered how fossils ... , The key lies in organic materials found ... ancient ecosystems functioned, according to a new study ... the Journal of Herpetology . Pre-human island ...
Breaking Biology News(10 mins):Eating five a day may keep the blues away 2Chimpanzees raised as pets or performers suffer long-term effects on their behavior 2Answer to restoring lost island biodiversity found in fossils 2
... New findings from a landmark clinical trial show that although ... to develop age-related macular degeneration (AMD), a potentially blinding eye ... do not predict how patients will respond to Lucentis and ... "wet" form of AMD. This new data from the Comparison ...
... change to current dosages for sleeping medications in women ... that flu dosages for women be reconsidered as well. ... common practice, but we aren,t there yet. To accelerate ... education and clinical training, the Sex and Gender Women,s ...
... from engineers at Rensselaer Polytechnic Institute and the University of ... powerful new tool for manipulating cells. Results of the study, ... blue light can be used as a switch to prompt ... process of clustering, or oligomerization, is commonly employed by nature ...
Cached Biology News:Major clinical trial finds no link between genetic risk factors and 2 top wet AMD treatments 2Sex and gender competency essential to medical care 2Nature Methods study: Using light to control cell clustering 2
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... /PRNewswire-Asia-FirstCall/ -- Genesis,Pharmaceuticals Enterprises, Inc. (OTC Bulletin ... pharmaceutical company with its principal operations in ... it engaged KPMG Huazhen,("KPMG"), a member firm ... firms,affiliated with KPMG International, to assist the ...
... & Company, LLC, a,Boston-based life science investment bank, ... joined the firm as senior advisor. In ... on internal and client-related activities including,merger & acquisition ... focus on biopharmaceutical transactions. "We are delighted ...
... PTNEW YORK, Jan. 13 Keryx Biopharmaceuticals, Inc. (Nasdaq: ... Weiss, the Company,s Chairman and Chief Executive Officer, is ... Healthcare Conference being held in San Francisco.Mr. Weiss, presentation ... 1:00pm PT and will be accessible from the Investor ...
Cached Biology Technology:Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 2Genesis Pharmaceuticals Appoints KPMG to Help Develop a SOX 404 Compliance Program 3Keryx Biopharmaceuticals to Present at the J.P. Morgan 27th Annual Healthcare Conference 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: