Navigation Links
World's least known bird rediscovered
Date:1/25/2010

A species of bird, which has only been observed alive on three previous occasions since it was first discovered in 1867, has been rediscovered in a remote land corridor in north-eastern Afghanistan. The discovery was made as part of an international collaboration, which included researchers at the University of Gothenburg, Sweden.

During the summer of 2008, the American ornithologist Robert J Timmins was commissioned by the American aid organisation USAID to compile an inventory of bird species in the Badakshan province in north-eastern Afghanistan. He managed to record the call of a species of bird that was as yet unknown.

Unheard birdsong

The recording found its way to the Swedish ornithologist Lars Svensson, who was quick to note that the recorded birdsong did not resemble that of any known species of bird. But from Timmins' description of the species, he soon began to suspect what kind of bird was on the recording.

Ornithological sensation

Lars Svensson and Urban Olsson at the Department of Zoology, University of Gothenburg, had in fact shown in a previous study that about a dozen stuffed birds in museum collections all around the world had been incorrectly classified: they were not of the common species of reed warbler the curators had assumed, but rather a far rarer species known as the Large-billed Reed Warbler (Acrocephalus orinus) - observed on just three documented occasions since 1867. In their previous study Svensson, Olsson and co-workers had pinpointed North-Eastern Afghanistan as an area where the Large-billed Reed Warbler probably bred in the 1930s. When both the Swedish colleagues heard the recording of the mysterious birdsong they realised that they were on the trail of an ornithological sensation.

World's least known bird

A year later, in June 2009, the Afghan ornithologists Naqeebullah Mostafawi, Ali Madad Rajabi and Hafizullah Noori from the Wildlife Conservation Societ
'/>"/>

Contact: Urban Olsson
urban.olsson@zool.gu.se
46-031-786-3453
University of Gothenburg
Source:Eurekalert  

Page: 1 2

Related biology news :

1. The best both of worlds -- how to have sex and survive
2. Quantum weirdness, parallel worlds, dinosaur poop, and the ultimate fate of the universe...
3. Girls prefer pink, or at least a redder shade of blue
4. 100 percent of people carry at least 1 type of pesticide
5. Failure of the 1st attempt at assisted reproduction justifies at least 1 additional cycle
6. Eat oily fish at least once a week to protect your eyesight in old age
7. K-State research: Freshwater pollution costs US at least $4.3 billion a year
8. Teenage boys who eat fish at least once a week achieve higher intelligence scores
9. Cretaceous octopus with ink and suckers -- the worlds least likely fossils?
10. Students least informed about environmental science are most optimistic
11. Wildlife Conservation Society finds worlds least known bird breeding in Afghanistan
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
World's least known bird rediscovered
(Date:4/17/2014)... NJ. April 16, 2014. Kessler Foundation has been ... million from the Department of Defense Spinal Cord ... principal investigator for the randomized, double-blinded, controlled, multi-site ... bone and muscle strength after spinal cord injury. ... & Engineering Research at Kessler Foundation. Two additional ...
(Date:4/17/2014)... births, Down syndrome - or trisomy 21 - is ... results from a chromosomal abnormality where cells of affected ... of the human genome). A study conducted by Stylianos ... Medicine and Development at the University of Geneva (UNIGE) ... light on how the extra chromosome 21 upsets the ...
(Date:4/17/2014)... ago, Katia Silvera , a postdoctoral scholar at the ... field trip in a mountainous area in central Panama when ... , Unable to identify it, they contacted German Carnevali, a ... be an unnamed species. So Carnevali recently named it after ... genus name, comprising about 40 species in the world. ...
Breaking Biology News(10 mins):Kessler Foundation awarded Department of Defense grant for spinal cord injury research 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 2Trisomy 21: How an extra little chromosome throws the entire genome off balance 3Orchid named after UC Riverside researcher 2Orchid named after UC Riverside researcher 3
... 2013) The Algae Biomass Organization (ABO), the trade ... of "Industrial Algae Measurements, Version 6.0" (IAM 6.0), ... by the organization for measuring and comparing algae ... new technologies to create fuels, feeds, nutritional supplements, ...
... this Moderate Resolution Imaging Spectroradiometer (MODIS) satellite image collected on ... Terra satellite and actively burning areas, detected by MODIS,s thermal ... is banned in Indonesia, but that does not always stop ... unusual dry spell in the area (this is usually the ...
... influence actual heart health, according to new research. A study ... ways in which your spouse is supportive and how ... on your overall cardiovascular health. The findings reveal that ... other as ambivalent that is, sometimes helpful and sometimes ...
Cached Biology News:ABO updates standards for measuring algae industry operations 2ABO updates standards for measuring algae industry operations 3ABO updates standards for measuring algae industry operations 4Heart disease risk linked with spouses' social support 2
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... CARY, N.C., May 19, 2011 ... its flexible 100% web-based Life Science Study Management ... successfully used globally by Leading European and USA ... eStudy,s on-line study design, management, communication, data collection ...
... CLARA, Calif., May 19, 2011 The 2012 federal ... National Nanotechnology Initiative (NNI), a federal interagency research and ... manipulation of matter at the nanoscale—a measurement of particles ... meter) in size.  While nanoscale materials are found in ...
... Inc., a Massachusetts-based biopharmaceutical company, announced today that it ... Administration on a Special Protocol Assessment (SPA) for a ... agent for patients with newly diagnosed prostate cancer. The ... with definitive results expected by 2015. The randomized study ...
Cached Biology Technology:Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 2Leading Ag Biotechnology Companies in Europe and America Save 50-80% of Field Study Management Time with eStudy 3Environmental Training Center Prepares Companies to Handle Nanotechnology Environmental and Human Safety Impacts 2Advantagene Announces SPA Agreement With FDA to Launch Phase 3 Trial for Novel Vaccine Aimed at Preventing Prostate Cancer Recurrence 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: