Navigation Links
Wind, salt and water are leading indicators of land degradation in Abu Dhabi
Date:5/6/2009

Desert environments are characterized by poor vegetative cover, strong winds, dry, non-cohesive sandy soils, and hyper-arid conditions. In this context, the land resources of Abu Dhabi Emirate in the United Arab Emirates are subjected to various land degradation stresses, including wind erosion, salinization, waterlogging, landfilling, and overgrazing. To sustain the land resources of Abu Dhabi Emirate, land degradation is a matter of urgency and must be accorded greater significance on the environmental agenda. Mahmoud Ali Abdelfattah, Environment Agency Abu Dhabi, studied representative samples from degraded soils and analyzed them for selected parameters relevant to specific indicators. He characterizes the major land degradation indicators in Abu Dhabi Emirate and suggests better conservation strategies and management options in a recent article in Soil Survey Horizons.

The study found that, among natural forces of land degradation, wind has a major role in moving soil from loose surfaces, and mainly in dune areas. Wind is the main cause of irreversible land degradation in the arid environment of Abu Dhabi. Wind erosion indicators are formation of fall dunes, blocking of highways, dust storms, nebkha features, reduction of waterways capacity due to deposition of sand, exposure of hardpans at the surface, and gravel lag. Nebkha dunes, formed from sediment accumulations around shrubs, have been considered a reliable indicator of rapid dryland degradation. As a preventive action, afforestation has been practiced on about 330,000 ha in Abu Dhabi Emirate. In addition, many green belts in urban areas and along roads have been established. Forestry plantations are an important effort in combating wind erosion and offer multiple benefits, such as hydrological balance, enhancement of environmental quality, habitat restoration, and improved aesthetic value.

Soil salinity is also a threat to agricultural farms and coastal areas. Due to the pr
'/>"/>

Contact: Sara Uttech
suttech@soils.org
608-268-4948
Soil Science Society of America
Source:Eurekalert

Page: 1 2

Related biology news :

1. Freshwater supplies threatened in central Pacific
2. University of Oregon researcher finds that on waters surface, nitric acid is not so tough
3. Innovative civil engineering application promises cleaner waters
4. Safe water: simpler method for analyzing radium in water samples cuts testing time
5. Researchers find new taste in fruit flies: carbonated water
6. Low oxygen in coastal waters impairs fish reproduction
7. Extra gene copies were enough to make early humans mouths water
8. Acid rain has a disproportionate impact on coastal waters
9. HARDY rice: less water, more food
10. New microsensor measures volatile organic compounds in water and air on-site
11. Alternative methods proposed to detect pesticides and antibiotics in water and natural food
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:10/16/2014)... war on the human body. Battles are won, ... pancreatic cancer, this stalemate—known as tumor dormancy—can last ... a phenomena that is poorly understood. , ... of Salvatore Torquato, a Professor of Chemistry at ... tumor dormancy and the switch to a malignant ...
(Date:10/16/2014)... and Washington land managers have a new synthesis of ... moist mixed-conifer (MMC) forests in the two states. ... in Eastern Oregon and Washington: A Synthesis of the ... a general technical report published by the U.S. Forest ... to a request from managers for a synthesis of ...
(Date:10/16/2014)... be cultivated efficiently, they are anything but sustainable: ... monoculture cultivation is becoming increasingly evident. Despite their ... and are regarded as the sole possibility of ... wrongfully, finds Bernhard Schmid, an ecology professor at ... form of agriculture and forestry. After all, a ...
Breaking Biology News(10 mins):Modeling tumor dormancy 2New report synthesizes best available science on management of moist mixed-conifer forests 2Plant communities produce greater yield than monocultures 2Plant communities produce greater yield than monocultures 3
... by biophysicist Stuart Lindsay from the Biodesign Institute ... reproducible single molecule negative differential resistor ?and in ... that provides a “roadmap?for designing single-molecule devices based ... 18 by Lindsay at the American Association for ...
... distinctive tissues, such as heart, bone, and brain. At ... arose from various sets of genes switched on inside ... lack a protein that permanently turns off neuronal genes ... it turns out that precursor nerve cells contain that ...
... Affymetrix Inc. (Nasdaq: AFFX), announced today the launch ... protocol developed in conjunction with PreAnalytiX -- a ... Prime Standard: QIA) and BD (Becton, Dickinson and ... Blood RNA System for use with Affymetrix GeneChip ...
Cached Biology News:Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 2Successful Test Of Single Molecule Switch Opens The Door To Biomolecular Electronics 3Gene keeps neural cells on correct developmental path 2Gene keeps neural cells on correct developmental path 3Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 2Affymetrix Launches New Globin-Reduction Kits and Protocol Developed with PreAnalytiX 3
(Date:10/22/2014)... and HONG KONG , Oct. ... disease therapeutics enterprise, announced today that rare disease expert ... as vice president, research. Dr. McKew brings more than ... leadership positions at the National Institutes of Health, Wyeth ... by Wyeth). Dr. McKew will lead aTyr,s efforts to expand ...
(Date:10/20/2014)... 20, 2014 /PRNewswire/ - BIOREM Inc. (TSXV: BRM) ("Biorem" or "the ... Q3 orders to $5.8 million and provides a good start to ... North America and one in the ... projects at record levels," said Peter Bruijns , President & ... end of Q3 than they have been for any complete year ...
(Date:10/20/2014)... 20, 2014 Earle Martin ... announced today that Ellen Teplitzky, an experienced attorney ... the pharmaceutical industry, has joined the firm as ... legal services practice. NDA Partners provides legal ... and testimony, to top law firms and their ...
(Date:10/19/2014)... The Asia-Pacific Bromine Market report defines and segments ... forecast of revenue. , Browse through the TOC ... get an idea of the in-depth analysis provided. ... in the Asia-Pacific bromine market, and is supported ... http://www.micromarketmonitor.com/market/asia-pacific-bromine-6741503144.html , Bromine is a volatile and ...
Breaking Biology Technology:aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 2aTyr Pharma Appoints John C. McKew, Ph.D., as Vice President, Research 3NDA Partners Appoints Ellen Teplitzky, JD as Director of its Legal Services Practice 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 2The Asia-Pacific Bromine Market is estimated to grow to $4,080.1 million by 2018 - New Report by MicroMarket Monitor 3
... Crosse, Wis. - Firstlogic, Inc ., a ... Crate and Barrel housewares retailer has deployed ... in its new customer management system initiative. , ,The ... quality in all aspects of its sales and communications ...
... calls to run government institutions as a business, with ... shareholders: taxpayers. Now schools are facing similar scrutiny. The ... Act have expanded the federal regulations with which schools ... also demanding more budget accountability at a time when ...
... Gov Jim Doyle on Thursday announced that three Wisconsin ... the Department of Commerce Technology Assistance Grant (TAG) and ... as follows: , , Functional Biosciences, Inc. ... provide DNA sequencing. It will receive a $250,000 TVF ...
Cached Biology Technology:Looking to software to manage the business of education 2Looking to software to manage the business of education 3Looking to software to manage the business of education 4
Mouse monoclonal antibody raised against a full length recombinant SLC25A11. NCBI Entrez Gene ID = SLC25A11...
Mouse polyclonal antibody raised against a partial recombinant SYT4. NCBI Entrez Gene ID = 6860...
Agarose II (Low Melt)...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
Biology Products: