Navigation Links
Will green tea help you lose weight?
Date:4/29/2013

Evidence has shown that green tea extract may be an effective herbal remedy useful for weight control and helping to regulate glucose in type 2 diabetes. In order to ascertain whether green tea truly has this potential, Jae-Hyung Park and his colleagues from the Keimyung University School of Medicine in the Republic of Korea conducted a study, now published in the Springer journal Naunyn-Schmedeberg's Archives of Pharmacology.

The active constituents of green tea, which have been shown to inhibit intestinal glucose and lipid uptake, are a certain type of flavonoid called gallated catechins. The authors had previously suggested that the amount of gallated catechins necessary to reduce blood glucose concentrations can be achieved from a daily dose of green tea. However, the amount of green tea needed to decrease lipid uptake from the gut is higher and has been shown to have adverse effects in humans. Once in the bloodstream, gallated catechins can actually increase insulin resistance, which is a negative consequence especially in obese and diabetic patients.

For their study, the researchers tested the effects of green tea extract on body weight and glucose intolerance in both diabetic mice and normal mice fed a high-fat diet. To prevent a high dose of gallated catechins from reaching the bloodstream, the authors also used a non-toxic resin, polyethylene glycol, to bind the gallated catechins in the gut to prevent their absorption. They then looked at the effects on the mice of eating green tea extract alone, and eating green tea extract plus polyethylene glycol. They compared these against the effects of two other therapeutic drugs routinely prescribed for type 2 diabetes.

Results showed that green tea extract in isolation did not give any improvements in body weight and glucose intolerance. However, when green tea extract was given with polyethylene glycol, there was a significant reduction in body weight gain, insulin resist
'/>"/>

Contact: Joan Robinson
joan.robinson@springer.com
49-622-148-78130
Springer
Source:Eurekalert

Page: 1 2

Related biology news :

1. LAMIS -- a green chemistry alternative for laser spectroscopy
2. Green Oakley Cluster to double OSC computing power
3. UH makes Princeton Reviews Green List 3 years in a row
4. Gladstone scientist Warner C. Greene receives Washington University School of Medicine Alumni Award
5. Analysis of speed of Greenland glaciers gives new insight for rising sea level
6. A practical guide to green products and services
7. Old aerial photos supply new knowledge on glaciers in Greenland
8. Weizmann Institute solar technology to convert greenhouse gas into fuel
9. Steel-strength plastics -- and green, too!
10. Ancient global warming allowed greening of Antarctica
11. UCLAs Yi Tang receives Presidential Green Chemistry Challenge Award from EPA
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: