Navigation Links
Wildlife Conservation Society releases definitive 'state of the wild'
Date:4/16/2008

State of the Wild allows us to think more broadly about living with wildlife as conservationists and stewards of the Earth.

State of the Wild draws on the intellectual resources of all WCS departments, while non-WCS authors represent institutions such as the World Wildlife Fund, The Nature Conservancy, Island Conservation, The National Aviary, and universities across the globe.

State of the Wild affords us a comprehensive, engaging look at the ecological health of our planet today. With careful, thoughtful essays that provide an up-to-date account of the state of conservation of species and ecosystems, this book is a call-to-action, a sobering analysis of global conservation and biodiversity and what the world is doing to help, said Maya Lin, environmental artist and advocate for sustainable design, who reviewed the book.


'/>"/>

Contact: Stephen Sautner
ssautner@wcs.org
718-220-3682
Wildlife Conservation Society
Source:Eurekalert  

0

GOOD

Page: 1 2

Related biology news :

1. Model connects circuit theory to wildlife corridors
2. Innovative model connects circuit theory to wildlife corridors
3. Wildlife Conservation Society study finds seasonal seas save corals with tough love
4. $2.8 million for research into the impact of climate change on tundra wildlife
5. New population of Iberian lynx raises hope, says World Wildlife Fund
6. Buying and selling habitats to help wildlife
7. Conservation of freshwater fish biodiversity: a challenge for the countries of the South
8. Rwanda conservation effort to link isolated chimps to distant forest
9. Nations and conservation groups seek plan to protect Ghost of the Himalayas
10. Open-access tropical conservation journal launches
11. Scripps expedition provides new baseline for coral reef conservation
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Wildlife Conservation Society releases definitive 'state of the wild'
(Date:6/17/2013)... bacteria, and algae, is a common component of sugar-free ... the medical field it,s approved by the FDA ... used during surgery as a substance that opens the ... , Now Profs. Ehud Gazit and Daniel Segal of ... and the Sagol School of Neuroscience, along with their ...
(Date:6/17/2013)... Ore. Amphibian populations are declining worldwide and a ... spread by bullfrogs, but a two-year study shows they ... that bullfrogs are a tolerant carrier host that just ... from eggs in controlled experimental conditions, they found at ... , also called Bd or a chytrid fungus, can ...
(Date:6/16/2013)... were fed a high-fat diet and became obese were ... levels of body fat, a new Ohio University study ... offspring, despite their consumption of a low-fat diet, scientists ... Society in San Francisco, Calif. , "We,ve identified a ... of offspring dependent on the pre-conception diet of the ...
Breaking Biology News(10 mins):Artificial sweetener a potential treatment for Parkinson's disease 2Bullfrogs may help spread deadly amphibian fungus, but also die from it 2Obese male mice father offspring with higher levels of body fat 2
... Saturday 02 April 2011: Data presented at the ... novel antiviral compounds for the treatment of hepatitis ... by experts and specialists to ensure resistance is ... of HCV resistance in patients treated with NS3-protease, ...
... (NASDAQ: AWRE ), a leading supplier of technology ... that Edmund C. Reiter has resigned, effective April 1, 2011, ... board of the company citing personal reasons.   ... have been named co-CEOs and co-Presidents on an interim basis. ...
... huge demands on water resources around the globe. ... major contributor to the nation,s economy, 85% of ... sector. The excessive use of irrigation water has ... where rising demand has deteriorated groundwater resources, depleted ...
Cached Biology News:Data suggest liver experts should take care when prescribing novel antiviral HCV drugs 2Aware, Inc. Announces Resignation of Chief Executive Officer 2Aware, Inc. Announces Resignation of Chief Executive Officer 3Research on satellite imagery aims to advance sustainable agriculture 2
(Date:6/18/2013)... 2013) A million electric cars could be on roads ... the help of research by the United States Department of ... , Professor Zhongwei Chen is part of a team led ... materials to replace the expensive platinum catalysts in fuel cells. ... fuel cells in vehicles is the cost of the units. ...
(Date:6/18/2013)... York, NY (PRWEB) June 18, 2013 ... innovation and sustainability, the Consulate General of Switzerland in ... solar boat, Switzerland’s MS Tûranor PlanetSolar , to ... part of its DeepWater Expedition 2013 tour with scientists ... led by Capitain Gérard d’Aboville, runs exclusively on energy ...
(Date:6/18/2013)... The Regulatory Affairs Professionals Society ... in Asia—one in Singapore and one in Shanghai, China. ... Pan-Asia office , serving the Asia Pacific region, and ... within China. , The announcement comes just a few ... government agencies to develop and implement a new ...
(Date:6/18/2013)... The human skin is the largest organ, ... human body part. Similar to the liver, or heart, the ... repair and grow. Recent reports from the mankatofreepress.com explained how ... as important as other life supporting organs. The article suggests ... cell reproduction, increase the appearance of skin, and fight off ...
Breaking Biology Technology:US and Canadian researchers drive towards cheaper fuel cells for electric cars 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 2Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 3Switzerland’s MS Tûranor PlanetSolar, the World’s Largest Solar Boat, Arrives in New York City 4RAPS Opens Offices in Singapore and China 2RAPS Opens Offices in Singapore and China 3Natural Acne Remedies Through Diet, Probiotic Action Shares New Insight on What Foods May Help Lead to Clear Skin 2
... Cynosure, Inc.,(Nasdaq: CYNO ), a leading ... aesthetic treatment systems, today announced that the company,will ... call on Tuesday,February 12, 2008 at 9:00 a.m. ... Executive Officer Michael Davin and,Executive Vice President and ...
... Introduced at Informex 2008, REDWOOD CITY, Calif., ... and leading developer of clean manufacturing,processes, today introduced ... can be used by pharmaceutical companies to more,rapidly ... lead,candidates., The Codex(TM) MicroCyp Plate is being ...
... Phase 1 studies show sobetirome, a selective thyroid hormone ... ... versus placebo, ANN ARBOR, Mich., Jan. 29 QuatRx ... endocrine, metabolic and cardiovascular diseases, today,announced results from two Phase ...
Cached Biology Technology:Cynosure to Announce Fourth-Quarter and Full Year 2007 Financial Results on February 12 2Codexis Launches Codex(TM) MicroCyp Platform to Produce Drug Metabolites and Novel Lead Compounds 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 2Phase 1 Studies Show Promise of QuatRx's Novel Compound, Sobetirome, for Lowering LDL Cholesterol Levels 3
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: